Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G015226-GRMZM2G073969
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100384020 (LOC100384020), mRNA
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.6329758561229
Log2 mRNA fold difference:-2.5196405812093
Log2 TE fold difference:-0.68659533564836
Sequences
Protein sequence

MAPKSLLVVAALLAVVVSACQLPRGATALEASPSTNTNTSLIVSGTVPCATGNSIDPATV
PAFPNALVQLVCGGKVVGSATADSAGAFVFSQSSASRDLVAAAMHNLCRVVVVTPLGACD
RSLAAAAGTLSAPLKLVGITTGSGSGSDLGGLGGLIGGIVGLIGAIVGGILNLSTMPFSF
V*

MAPTKSHVLLAALLTVVAAVGQTPRAAEGFNIPGLGSMLNPIPVVAGVVPCSIGSSINPA
LVPGFPNANVQLMCGGTVVANATTSITGSFILTPVNATLGLFSSMLGGQCNVVVTTPLVA
CNASLAGATGTLTAPLQLLGSGTGIAGGGSSTIIATIAGQPFTIINEMIIFTTGLSSLA*

Other information
Ka divergence:0.141026KaKs divergence:-0.248371
GC content 1 (%):70GC content 2 (%):63GC content divergence:-0.053
Length 1 (bp):546Length 2 (bp):540Length divergence:-0.006
MFE 1 (kcal):-267.58MFE 2 (kcal):-217.5MFE divergence-0.103