Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G015314-GRMZM2G086766
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383157
Function (paralog2):hypothetical protein LOC100383504

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5896406260309
Log2 mRNA fold difference:0.047940261902116
Log2 TE fold difference:-1.6452134924185
Sequences
Protein sequence

MYPYRMSNVAIGYLNLATLLASIPVIGAGLWLAKGSATPTCSSILQAPLLAVGFAVLLVS
LAGFVGACFHVAWALWLYLAAVMLLIAFLLGLTVFGFAVTAGGGGEQVYGRPYREYRVAD
YSPWLQRHVRDARYWRPALACVVGSRACPKIHNWTPMDYLQHDLTPIQSGCCKPPTACQY
SGGVAVGAQDEDCYRWNNAPGVLCYQCDSCKAGVMEQVRQDWHKIAVLNVVVLVALVCIC
SCGCCAFRNARRSLSEYPYGVNQMSKIDPRWDYYWWRWWRGRREQLY*

MYPYRMSNVMIGYLNLATLLASLPIIGAGLWLARGSSSSSSTTCSSILQTPLLAVGFAAL
LVSLAGFVGACFHVAWALRLYLAAVALLVAFLLGLTAFGFAVTAGGGGAQVYGRPYREYR
VTDYSAWLQKRMQDDRYWRPALACVVGSKACPKIQNWTPMDYLQHDLTPIQSGCCKPPTA
CQYSGGMPVGAQDEDCYRWNNAPDILCYRCDSCRAGVMEQVRQDWHKIFVLDVAVLAALV
CICSCGCCAFRNARRSRSQYPYGVNQTSKINPRWDYWYSKRESSVVYSLCFLPLIVCRVK
FKIGDVISTTAEDNLIGQ*

Other information
Ka divergence:0.0069131KaKs divergence:0.355956
GC content 1 (%):67GC content 2 (%):63GC content divergence:-0.031
Length 1 (bp):864Length 2 (bp):957Length divergence:0.051
MFE 1 (kcal):-404.5MFE 2 (kcal):-433.9MFE divergence0.035