Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G015344-GRMZM2G085960
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC542168
Function (paralog2):hypothetical protein LOC100274097

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.0076235357283197
Log2 mRNA fold difference:1.39868686511
Log2 TE fold difference:-1.419778130404
Sequences
Protein sequence

MGQDGQQIRRDKLIIDTDPGIDDSMTILMAFRAPSVEIIGLTTIFGNVDTKGATRNALLL
CERAGCPEVPVAEGSHEPLKGGKPRVADFVHGSDGIGNLFLPAPSAKKVEESAADFLINK
VSEFPGEVSVLALGPLTNVALAIKRDPSFASKVKKIVVLGGAFFAAGNVNPAAEANIHGD
PEAADIVFTSGADIVVVGINITTQVCLTDEDLLELRNSKGKHAAFLYEMCKFYRDWHAKS
DGFHGIFLHDPVSFTAVLHPEYFTFKKGVVRVETQGICTGHTLMDQGLKKWNSENPWSGY
KPISVAWTVDVPKVISFIKKLLMAP*

MERDGQQTRRDKLIIDTDPGIDDSMAILMAFRAHTLEIIGLTTIFGNVDTEGATCNALLL
CERAGHPEVPVAEGSHEPLKGGKPRIADFVHGSDGIGNLFLPAPSAKKVEESAADFMVNK
VSEFPGEVSVLALGPLTNVALAIKRDPSFASKVNKIVVLGGAFFVAGNVNPAAEANILGD
PEAADIVFTSGADVIVVGINITTQVCLTDEGLLELRNSKGKHAPFLSETCKFYRDWHVKS
DGFHGIFLHDPVSFTAVLHPEYFTFKKGVVRVETQGICTGHTLMDQGLKKWNSENPWSGY
KPISVAWTVDVPKVIGFVKKLLMAP*

Other information
Ka divergence:0.293545KaKs divergence:-0.578604
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):978Length 2 (bp):978Length divergence:0
MFE 1 (kcal):-337.77MFE 2 (kcal):-344.11MFE divergence0.009