Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G015401-GRMZM2G152827
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):mitochondrial phosphate transporter

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.15240939144226
Log2 mRNA fold difference:0.61555037349568
Log2 TE fold difference:-0.46406466773235
Sequences
Protein sequence

MALSDRSRESLLPSFLYGSSARSFAATGAAARLPVSSPAPAAAGAGGGVPFSIQAPKEKI
EMYSPAFYAACTAGGIASCGLTHMAVTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGAR
GFFRGWVPTLLGYSAQGACKFGFYEFFKKYYSDIAGPEYAQKYKTLIYLAGSASAEVIAD
VALCPFEAVKVRVQTQPGFARGLSDGLPKFVRSEGVLGLYKGIVPLWGRQIPYTMMKFAS
FETIVELIYKHAVPVPKSECSKTTQLGISFAGGYVAGVFCAIVSHPADNLVSFLNNAKGA
TVGDAVKKLGLWGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVMVGLPTTGGVTPAPAAEA
ELKASA*

MALSDRSRESLLPSFLYASSARSFAATGAAARLPVSSPAPATAGAGGGVPFSIQAPKEKI
EMYSPAFYAACTAGGIASCGLTHMAVTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGAR
GFFRGWVPTLLGYSAQGACKFGFYEFFKKYYSDIAGPEYAQKYKTLIYLAGSASAEVIAD
VALCPFEAVKVRVQTQPGFARGLSDGLPKFVRSEGVLGLYKGIVPLWGRQIPYTMMKFAS
FETIVELIYKHAVPVPKSECSKTTQLGISFAGGYIAGVFCAIVSHPADNLVSFLNNAKGA
TVGDAVKKLGLWGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVMVGLPTTGGVTPAPAAEA
ELKASA*

Other information
Ka divergence:-0.118527KaKs divergence:0.324107
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):1101Length 2 (bp):1101Length divergence:0
MFE 1 (kcal):-413.9MFE 2 (kcal):-403.55MFE divergence-0.013