Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G015610-GRMZM2G044382
Species:maize
Duplication type:WGD
Function (paralog1):catalytic/ protein phosphatase type 2C
Function (paralog2):catalytic/ protein phosphatase type 2C

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.36668327443584
Log2 mRNA fold difference:0.0054162874998233
Log2 TE fold difference:-0.37539831375618
Sequences
Protein sequence

MSASRSGRIRRAGSVALGDFLRREASAERAALGGGERPSVAAGQACRAKKGEDFALLKPA
CERRPGAPSTSFSAFALFDGHNGSAAAVYAEEHLLANVLGCVPADLSRDDWLAALPRALV
AGFVKTDKDFQTKAHSSGTTVTLAIIDGSVVTVASVGDSRCVLDAAGSIYYLSADHRFDA
NEEEVGRVTECGGEVGRLNVVGGAEIGPLRCWPGGLCLSRSIGDQDVGEFIIPVPYVKQI
KLSNAGGRLIISSDGVWDALTAEMAFRCARGLPPEAAAEQIVKEAVESKGLRDDTTCIVI
DIIPPEKQKCTIESPKTPGKGLVLLKNFFLRKTASGSLSLADKDNYPEPDFVEEVFEDGC
PSLSRRLNSEYPVRDMFKLFACAICQIDLESGQGISIHEGSSKTGKLRPWDGPFLCHSCQ
EKKEAMEGKRHSRDSSSRNSGSSE*

MSASRSGRRRTGSVALGDLLQREASAERAALGCGERPSVAAGQACRAKKGEDFALLKPAC
ERRPGAPSTSFSAFALFDGHNGSAAAVYAKEHLLGNVLSCVPTDLAWDDWLAALPRALVA
GFVKTDKDFQTKAHSSGTTVTLAIIDGSVVTVASVGDSRCVLEAEGSIYYLSADHRFDAN
EEEVGRVTECGGEVGRLNVVGGAEIGPLRCWPGGLCLSRSIGDQDVGEFIIPVPYVKQIK
LSNAGGRLIISSDGVWDALTAEMAFKCARGLPPEAAAEQIVKEAVEAKGLRDDTTCIVID
IISPEKPKRTIQSQRTPGKGLVLLKNFFLRKTTSDSLSLPDKDNYPEPDLEEVFEDGCPS
LSRRLNSEYPVRDMFKLFACAICQIDLESGQGISIHEGLSRPGKLRPWDGPFLCHSCQEK
KEAMEGKRHSRDSSSRNSGSSES*

Other information
Ka divergence:-0.0284045KaKs divergence:-0.106038
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):1335Length 2 (bp):1332Length divergence:-0.001
MFE 1 (kcal):-514.57MFE 2 (kcal):-507.04MFE divergence-0.007