Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G015881-GRMZM5G868767
Species:maize
Duplication type:WGD
Function (paralog1):transcription regulator
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.94322906717184
Log2 mRNA fold difference:-0.45045867209714
Log2 TE fold difference:1.392559869084
Sequences
Protein sequence

MASDTEGIAALFSMYNDDEEEEDADEPSPPFPALPAAVTSSSPLSPQAGAEDPNPSVAPP
SPSRPEELASLKTLASPHPSPARGLLPPLPSRRSSSPFAVSSPSPLRGPFFAPPADLPRP
PRRGALAIVDYAHDETAMSPEQEDGEITSNTYGFGSDAQAAEGNLEERTYSGTVHVMTPN
TLAELSQHPDAPEQNQVGTDMAVDVTRTEIKGAQVEGTTDISTNGESDDPSNRFLPPPVT
TKCSAALQQKINRFLAYRRAGKSFNAEVRNRKDYRNPDFLQHAVGYQEIDQIGTCFSKYV
FDPYGYDKGDYYDEIEAEMKREVERKEQEKKRSPKVEFITGVQPPINASIPKIPGLAGVC
TLPVPTEGVQKETRPNKKSKWDKVDGDVKNHVVPSGHDNLSATTAALLTSANVGAGYAGF
AQQKRKEAEEKKNDHKSDRRS*

MASDTEGIAALFSMYNDDEEDEDADEPNPPSPAPLTTVTSSSPLSPQAGGEDPNPSLAPP
SPPRPEESASLKTLVSPHPSPARALLPPLPSRRSSSPFAASPPSPLRGPSSAPPADLPRP
PRRGALAIVDYAHDEMAMSPEQEDGEIMSHTYRFVSDAQAAEGNLEERTLSGTVHIMTPN
TPAELSQHADAPEQNQLGTDMAVDITRAEIEDAQVEETTDISTNGENDDPLSRFLPPPVT
TKCSAALKQKINKFLAYKRAGKSFNAEVRNRKDYRNPDFLQHAVRYQEIDQIGTCFSKDV
FDPYGYDKGDYYDEIEAEMKRELERKEQEKKRNPKVEFITGGVQTPHSASIPKIPGLAGV
CTLPVPTEGVQKETRPNKKSKWDKVDDDVKNHVVPSGHDNLSATASVALLTSANVGAGYA
AFAQQKRKEAEEKRSDHKSDRRS*

Other information
Ka divergence:-0.255316KaKs divergence:-0.294752
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):1326Length 2 (bp):1332Length divergence:0.002
MFE 1 (kcal):-444.24MFE 2 (kcal):-435.75MFE divergence-0.01