Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G016439-GRMZM2G451604
Species:maize
Duplication type:WGD
Function (paralog1):histidine-containing phosphotransfer protein
Function (paralog2):his-containing phosphotransfer protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1281439821841
Log2 mRNA fold difference:-1.4863152756242
Log2 TE fold difference:0.3922670616769
Sequences
Protein sequence

MSAANQLAALVSNMYATGLLDDQFQQLQLLQDPSAPDFVSEVVTLFCQDGERIIEELAKL
LEKPNVDFDRVDAFVHQLKGSSANIGAQKVKNTCIQFREFCQQKSRDGCLKVLETMRINF
YELRGKFQTMLQLERQVNGFPPNK*

MSAANQLAALVSNMYATGLLDDQFQQLQMLQNASTPDFVSEVVTLFCQDGERIIGELAKL
LEKPNVDFDRVDAFVHQLKGSSASIGAQKVKNTCIQFRESCQQKSKDGCLKTLETVKINF
YDLRDKFQTMLQLQRQIFQVGGDVRGGQPATDSNETCCCSVRFRAFAPRNNSVTQSGGID
GVGCWDDAYNTSFRIKGRVQ*

Other information
Ka divergence:0.314151KaKs divergence:0.500387
GC content 1 (%):54GC content 2 (%):51GC content divergence:-0.029
Length 1 (bp):435Length 2 (bp):603Length divergence:0.162
MFE 1 (kcal):-156.81MFE 2 (kcal):-208.92MFE divergence0.142