Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G016622-GRMZM2G016066
Species:maize
Duplication type:WGD
Function (paralog1):LOC100283085
Function (paralog2):photosystem I reaction center subunit IV A

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASTNMASATSRFMLAAGVPTGSSGGRVNFASAPNRLGRRLVARADNEAAAAEAAEGEGA
VATKPKAEKPPPIGPKRGAKVKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKVNYA
GVSTNNYALDEVSEVK*

MASTNMASATSRFMLAAGVPTASSGSGRVSFASAPNRLGRRLVVRADEESPAEPAPTAEG
EGAVATKPKAEKPPPIGPKRGAKVKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKV
NYAGVSTNNYALDEILEVK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):67GC content 2 (%):66GC content divergence:-0.008
Length 1 (bp):411Length 2 (bp):420Length divergence:0.011
MFE 1 (kcal):-189.04MFE 2 (kcal):-198.6MFE divergence0.025