Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G016705-GRMZM2G097848
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100277044

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0280029929294
Log2 mRNA fold difference:-1.7443489992139
Log2 TE fold difference:0.72063954117175
Sequences
Protein sequence

MATASVATSLPFGLLLPPRLFRGRLVRWPRQIRASASSNASNVAGGERKLGALKGRVGDL
RALVASMPDAVGSIQKNIGPNFVAGFCVGIAFLAAVARQITLRSREHDNKGSVADLVRRG
QLKSGQRGTAKPRTFDDPFNNPLVKIDEGTSTVQMFGKEYRLAPVRLTKEEQEMHQKRRS
RAYQWKRPTVFLREGDSLPPDVDPDTVRWIPANHPFAAASSEVDEETAKQNVYQKDGVPS
RVKAEHEALQARLEASNDVTRLPPDPRSMQRNERQMELSGKPSENLQGSKFENQDRQLVI
ESGKHSSDGSLQSNEPEGQ*

MAIAAVPASLPFVLLPPRLFRGRAVRWPRPIRASASTNAGDVAGGERKFGALVSRVGDLR
ALVASVPPAVASMQKNIGPNFVAGFCVSMAFVAAAARQISLRSREHVSKGSVADLVRRGQ
LKSGQRGIAKLRTYDDPFNNPLVKIDEGTSTAQMFGKEYRLAPVRLTKEQQEMHQNRRSR
AYQWKRPTVFLREGDSLPPDVDPDTVRWIPANHPFSAASSEVDEETAKQNVYQKDGIPSR
VKAEHEALQARLEASNDVTRLPSDPRSIQRNERPMRLSGKPSEHLQSSKFENQDRQLATE
SGKHSSESLMDVYNQTSRKGNKNCVLQLFEDICFVT*

Other information
Ka divergence:0.372226KaKs divergence:0.27025
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):960Length 2 (bp):1011Length divergence:0.026
MFE 1 (kcal):-329.68MFE 2 (kcal):-356.6MFE divergence0.039