Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G016734-GRMZM2G134476
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273261
Function (paralog2):hypothetical protein LOC100274587

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1410406454942
Log2 mRNA fold difference:-1.7692811425699
Log2 TE fold difference:0.68368148006579
Sequences
Protein sequence

MDGGGSGNASGGSGGASTCCYYALLGIRKNASATDIRAAYRRLAMKWHPDRWASDPGAAG
EANQRFQRIQEAYSVLSDKGKKAMYDAGLFDPLDDDDQDFSDFMQEMLVMMDSVKNEKPD
TLEDLQKMLEDIVKGDGGGGSGAGGRAPTDGARRTRVAPYPQPQRARR*

MDGGSGNASSGGAAVCCYYALLGVRKSASATDIRTAYRRLAMKWHPDRWASDPGAAGEAK
RRFQRIQEAYSVLSDKGKKAMYDAGLFDPLDDDDQDFSDFMQEMLVMMDNVKNEKPDTLE
DLQKMLADIVNGDGGDGVGGRVPPAPPDVARRTRVAPHPQPQQARR*

Other information
Ka divergence:0.0354403KaKs divergence:0.0424766
GC content 1 (%):68GC content 2 (%):67GC content divergence:-0.007
Length 1 (bp):507Length 2 (bp):501Length divergence:-0.006
MFE 1 (kcal):-239.9MFE 2 (kcal):-235.3MFE divergence-0.01