Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G016749-GRMZM2G443509
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282590
Function (paralog2):hypothetical protein LOC100274745

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.77929460651383
Log2 mRNA fold difference:0.45294819943435
Log2 TE fold difference:0.31717542467448
Sequences
Protein sequence

MVDVELFYKDTSDHSISSEEEDMLVRSCSNLNVSFGYHCDSYQSFSPENDHGNDISPKNM
FGTNTMMGSRNGSFTCLSGAAISANFTLANTNICNGLIGEEILPELDSPNSFRKIISSPS
MSRLDSFSTSQGSPVSTESSIFEISKNIWRSSAPTTVSSNFLTNTEVKMAGGAAGEDRVQ
AVCSEKNGWLICGIYDGFNGRDAADFLAVTLYDNIVYYLYLLENRIRQQNGLYNSSESSL
NGLKSELTLAMRNSENEGIKFSETFRSGVLNCLSTAVEQAENDFLCMVEQEMDDRPDLVS
VGSCILVVLLQGTDLCILNMGDSRAVLASMPYVENGALKATQLTETHSLENPLEYQKLLA
EHPNDSSVVRGNKIKGKLKVTRAFGVGYLKQRKFNDALMGILRVRDLSSPPYVYTNPHTL
SHKVTDDDLFVVLGSDGLFDFFSNDEVVRLVYQFMHDNPMGDPAKYLIEQLILKAAKEAA
LTAEELMRIPVGSRRKYHDDVTVIVIILGNAQRTMTASTSL*

MVDVELFVKETSDHSISSEEEDILVRSCSNLNVSFGYHCDSHQSFSPENDHGNGISPKNT
FGTNTMMGSRNGSFTCLSGAAISANFTLANTNICNGLIGEEILPELDSPNSFRKIVSSPS
MSRLDSFSTSQGSPVSTESSIFEISKNLWRSSAPTTVSSNFLTNTEVKMAGGAAGEDRVQ
AVCSEKNGWLICGIYDGFNGRDAADFLAVTLYDNIVYYLYLLENRIKQQNGLYNSSESSL
DGLKSELTLAMRNSENEDIKFSETFRSGVLNCLSTAVEQAENDFLCMVEQEMDDRPDLVS
VGSCVLVLLLHGTDLCILNMGDSRAVLASMPYVENGALKAAQLTETHSLENPSEYQRLLA
AHPNDSSVVRGNKIKGKLKVTRAFGVGYLKQRKFNDALMGILRVRDLSSPPYVYTNPHTL
SHKVTDDDLFVVLGSDGLFDFFSNDEVVLLVYQFMHDNPMGDPAKYLIEQLILKAAKEAA
LTAEELMRIPVGSRRKYHDDVTVVVITLGNAQRTERMEVFIHEDYVNKRNELRREQRRRE
LQRLQVESNPDASREALASRESPRTPAQCLTPTGASPSSFRSPTSRSTLQSPAAAAGQAA
GWPSEHRRLYDCLKPY*

Other information
Ka divergence:0.529692KaKs divergence:0.632775
GC content 1 (%):40GC content 2 (%):46GC content divergence:0.07
Length 1 (bp):1566Length 2 (bp):1851Length divergence:0.083
MFE 1 (kcal):-460.6MFE 2 (kcal):-603.63MFE divergence0.134