Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G016892-GRMZM2G034122
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279572
Function (paralog2):hypothetical protein LOC100381916

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7410585688857
Log2 mRNA fold difference:-1.4452233530232
Log2 TE fold difference:-0.23400785814135
Sequences
Protein sequence

MAAAVAAVAAATTAEDEARLLRLEEQAEHGGGGAWDYLCLARRLRARRPAHVLRVGLALL
NNASARSGLASEQWTLYEQVATAAMDCQRLDVAKDCIGVLSKQFPGSTRVARLEALLFEA
KSEWAEAERAYTQILEINPFDQIVHKRKIAIAKAQGNMSLAIGYLNKYLELFMADHDAWR
ELAETYVSLQMYKQAAFCYEELILSQPTIPLYHIAYAEVLYTMGGLENLQTAKKYYASTI
QLTGGKNTRALFGVCLCTSAINQLTKGRNKEEEGSELQRLAAEVLLNNYKQQAPSKAPLI
SSLLKNMKLS*

MAAAAAVASATTAEDEARLLRLEEQAEHGGGGAWEYLCLARRLRARRPAHVLRVGLALLN
NASARSGLASEQWTLYEQVATAAMDCQRLDVAKDCIGVLSKQFPGSTRVARLEARLFEAK
GEWAEAERAYALILENNPFDQIVHKRKIAIAKAQGGMSIVIDYLNKYLELFMADHDAWRE
LAETYSSLQMYKQAAFCYEELILAQPTIPLYHIAYAEVLYTMGGLENLQTAKKYYASTIQ
LTGGKNTRALFGVCLCTSAINQLTKGRNKEEEDSELQSLAAEVLLKNYKQQAPSKAPLIS
SMLKNMKLS*

Other information
Ka divergence:-0.189639KaKs divergence:-0.423372
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):933Length 2 (bp):930Length divergence:-0.002
MFE 1 (kcal):-341.72MFE 2 (kcal):-334.7MFE divergence-0.01