Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G016894-GRMZM2G437119
Species:maize
Duplication type:WGD
Function (paralog1):LOC100279326 (cl12292_1a), mRNA
Function (paralog2):hypothetical protein LOC100272567

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.68246142397247
Log2 mRNA fold difference:-0.50938515131412
Log2 TE fold difference:-0.13392625599842
Sequences
Protein sequence

MSQPAATVAAAAQPQGRGPAGRQGGLGQSIAGIVRMAVFWYFASKFFGPKRPPADPGMLM
SNLFQKGEPMDMWMYLSENEKFNDFANEDALIWHEANIPYAVWGPTSTRTRSLTYYPSEA
LKHNGSLYAHVYFAPFGVILWTLQIQNMSRNLRLGGPIVSVVAFLPKSKAGKKKSLLGDS
EEPEEKAPRNKENKESEDKDEGPTEYISYWKPNVTINLVEDFTRLTDLNVDPVTGDYYPT
VFFNEFWLLKDKLIALNETVEELPLNLEVGPISMTKWQLFLQIEQSFQVHRSYGSMLEGE
ADELKRVFLEGNPYLLGLTMVVSLLHSLFDFLAFKNDIQFWNKNKSMEGLSAKSVVLNFV
CQLVVFLYLLDNDTSWMILASSGVGVCIEFWKIGKAMHIEVDRSGKIPMLRFRDRESYAQ
NKTKEYDAIAMKYLTYVLFLLVVGFSIYSLKYEKHKSWYSWILSSMTSCVYMFGFIMMCP
QLFINYKLKSVAHMPWRQMTYKFLNTIIDDLFAFVIKMPMLHRLSVFRDDVIFLIYLYQR
WKYPVDKKRVNEFGFGGEDEPAAQEAVEGSDSAAAPQLTEAGSETSTEDKKTK*

MSQPTAAVAAEAQPQGRGLAGRQGGGGGLGQSISGIVRMAVFWYFAAKFFGPKRPPADPG
MLMSNLFQKGEPMDMWMYLSESDKFNDFANDDALIWHETNIPYAVWGPTSTRTRSLTYYP
SEALKHNGSLYAHVYFARSGYPVDPTDPEYEQKSAFGRTHPVVAFLPKSKAGKKKSLLGD
SEEPEEQAPPKENKELEDKDEGPTEYLSYWKPNVTVNLVEDFTRYPNNNVPAIVASYLNV
DPATGDYYPTVFFNEFWLLRDKLIALNESVKELPLNLEVGPISMTKWQFFLQIEQSFQVH
RSYGSMLEGEADELKRVFLEGNPYLLGLTMIVSLLHSLFDFLAFKNDIQFWNKNKSMEGL
SAKSVVLNFVCQLIVFLYLLDNDTSWMILASSGIGVCIEFWKIGKAMHIEVDRSGKIPML
RFRDRESYAQNKTKEYDAIAMKYLTYVLFLLVIGFSIYSLKYEKHKSWYSWILSSMTSCV
YMFGFIMMCPQLFINYKLKSVAHMPWRQMTYKFLNTIIDDLFAFVIKMPMLHRLSVFRDD
VIFLIYVYQRWKYPVDKKRVNEFGFGGEEEPAAQETLEGSDPAAAAAAAEPTEDKKTK*

Other information
Ka divergence:-0.19574KaKs divergence:0.00863436
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1782Length 2 (bp):1797Length divergence:0.004
MFE 1 (kcal):-585.6MFE 2 (kcal):-565.8MFE divergence-0.017