Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G016930-GRMZM2G041822
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216757
Function (paralog2):hypothetical protein LOC100191199

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.031278206989
Log2 mRNA fold difference:0.72735252733287
Log2 TE fold difference:0.23734098163553
Sequences
Protein sequence

HKPPTSRSTSSDPAPHHKGTNPQSPLRYLSPSRLPVDRQRDFRVLAASISERGFIRQGRR
DAAAVELGFPSHPVPFQARRWTRRRSTTSSGGSSRPAAGAPPRNAQVTDAEIRRLCAAAK
DVFLSQPNLLELEAPIKICGDVHGQYSDLLRLFEYGGYPPDANYLFLGDYVDRGKQSIET
ICLLLAYKIKYPENFFLLRGNHECASINRIYGFFDECKRRFNVRIWKIFTECFNCLPVAA
LIDDKIFCMHGGLSPELKSMDQIRNISRPVDVPDVGLLCDLLWSDPDKEIDRWGENDRGV
SYTFGADVVAEFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGALM
SIDNSLVCSFQILKPSEKKGKAGNGNMPKPGTPPRKIKISVTHI*

MDEAAIDDLIRRLLEARGGRTPRNAQVTDAEIRRLCATAKDVFLSQPNLLELEAPIKICG
DVHGQYSDLLRLFEYGGYPPDANYLFLGDYVDRGKQSIETICLLLAYKIKYPENFFLLRG
NHECASINRIYGFFDECKRRFNVRIWKIFTECFNCLPVAALIDDKIFCMHGGLSPELKNM
DQIRNISRPVDVPDVGLLCDLLWSDPDKEIVGWGENDRGVSYTFGADIVAEFLQKHDLDL
ICRAHQVVEDGYEFFANRQLVTIFSAPNYCGEFDNAGALMSIDDSLVCSFQILKPSEKKR
KAGAENMPKPGTPPRKIKISVTRI*

Other information
Ka divergence:-0.594521KaKs divergence:-0.513196
GC content 1 (%):51GC content 2 (%):49GC content divergence:-0.02
Length 1 (bp):1215Length 2 (bp):975Length divergence:-0.11
MFE 1 (kcal):-417.4MFE 2 (kcal):-334.72MFE divergence-0.11