Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G017016-GRMZM2G175718
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273897
Function (paralog2):hypothetical protein LOC100191985

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-3.075441911779
Log2 mRNA fold difference:-2.017779303185
Log2 TE fold difference:0
Sequences
Protein sequence

MSTEATLNNSGGSESALLLLEQLAEVFGKLKTHTETFLHLQNGIKWEDIEGHFLSLDESY
RSKFDELVEKEKALEEKKAEACRLIAEKEAKVSTKEHASLNQLQELRDAAVSSLAEVRQK
YKVELAEILEASGSKDKKVSTSINDNNASRASEENTPASGSGEASEALPVETKPRPVLKQ
LCEQMDTKGLLKFLSENCRKLASFRDELSVALKCATDPARFVLNSLEGFFPPDQTNSPGS
KHNALEVQRKSCILLMEAIAPALGMKEPGGDDPWSSEIKEQAKEIAEEWKSKLAEIDLDA
SNGYSLEAQAFLQLLTTFNVDSVLDEDELCKIVVAVSRRKQTAVSCRSLGLNEKVPGIIE
ELVKRHRQIDAVHFIQAFGLSETFPPAPLLKTYVEEQKDTIENNGDATAISLTDDPKSRE
LIALRAVIKCIEEHKLQKECSLGPLQKRVSELKPKGEKRPSSDAGRTYAKKPRGPGISFP
RRPAGSVGSAARRPPFPGYTWQRAPAPMPSRGPAPVPSRAPLPAPLPDRYGAADRYHYTP
PAPAYDSGAFSSYSEPFSAPKPFQYTPGSVAASYNSSPYKVAYGGPGAPVRSTYPGYASA
SGPAASSSYANYMGSVYRPPQQP*

MDTEATLNKSGGSESVMSLLEQLAEVFGNLKSHTEAFLQLQNGMQWEDIKGHFLSLDKSY
GSKFDELVEKQKALEEKKAEACRLIAEKEADISIKERASLNQLQELRDAAVSSLAEVRQK
YKVELAEILDTSESKYKKVSTSINDSNASLASEENTLATGSGEASEASPVETKPRSVLKQ
LCEQMDTKGLLKFLSVNCRKLATASLRAELSVALKCATDPARLVLNSLEGFFPPEQTNSP
GSEHNGLQVQRKSCIVLMDAIAPALGTKEPGGNDPWSSEIKEQAKAIAEEWKSKLAEVDL
DASNGYSLEAQAFLQLLTTFNVDSVLDEDELCKIVVAVSRRKQTAVSCRSLGLNEKIPGI
IEELVKRHRQIDAVHFIQAFGLSETFPPAPLLKTYIEEFKDTIENNGDATVSLLKDDPKS
RELLTLRAVIKCIEEYKLQKEYSLGPLQKRVSELKPKGEKRPSTDAGGRTYAKKPRGPGI
SFTRRPGGSIGSAARRPPFPGYSWQRAPAPMPSHGPAPMPSRAPLPDGYGAADRYHYTPP
APAYDAGAFSSYGEPFSTPKPFQYAPGSVAASYNSSPYKIAYGGPGAPAASAYAGYSGGA
QAPAASAYTGYSGGSGPAASSSYANYLGSVYCPPQQP*

Other information
Ka divergence:0.0234261KaKs divergence:-0.14893
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1872Length 2 (bp):1914Length divergence:0.011
MFE 1 (kcal):-606.43MFE 2 (kcal):-649.54MFE divergence0.034