Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G017077-GRMZM2G024607
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191375
Function (paralog2):hypothetical protein LOC100192628

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.2392037389488
Log2 mRNA fold difference:-0.59463206464786
Log2 TE fold difference:0.32406645359865
Sequences
Protein sequence

MEIRAPPTSLRLAPPPAAASFRRTPLRTSFLRGSVSLKVVQVRQSNVNRFKCNSIRSNLF
DRLTRVVRSYANAVLSSFEDPEKILDQAVLEMNDDLTKMRQATAQVLASQKRLENKYKAA
EQASADWYRRAQLALQKGDEDLAREALKRRKSYADNASSLRSQLDQQKGVVENLISNTRL
LESKIAEAKQKKDTLKARAQSAKTATKVSEMLGNVNTSSALSAFEKMEEKVMAMESQAEA
LGQLATDDLEGKFALLETSSVDDDLSQLKKELSGSSLKGELPPGRTAVSNSGAGRPFPDL
EIESELNELRRKAKEY*

MEIRAPPTSLSLAPPPASASFRRTPLRTFFLNGSVSLKVVQVRQSNVNRFKCNSIQSNLF
DRLTRVARSYANAVLSSFEDPEKILEQAVLEMNDDLTKMRQATAQVLASQKRLENKYKAA
EQASADWYRRAQLALQKGDEDLAREALKRRKSYADNASSLRSQLDQQKGVVENLISNTRV
LESKIAEAKQKKDTLKARAQSAKTATKVSEMLGNVNTSSALSAFEKMEEKVMAMESQAEA
LGQLATDDLEGKFALLENSSVDDDLSQLKKELSGSSLKGELPSGRRAASNSGAGRPFPDL
EIESELNELRRKAKEY*

Other information
Ka divergence:0.646888KaKs divergence:0.256765
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):951Length 2 (bp):951Length divergence:0
MFE 1 (kcal):-336.42MFE 2 (kcal):-332.62MFE divergence-0.006