Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G017186-GRMZM2G172043
Species:maize
Duplication type:WGD
Function (paralog1):LOC541703
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1545979446721
Log2 mRNA fold difference:-3.2964961725619
Log2 TE fold difference:2.153282880594
Sequences
Protein sequence

MGGELAGRIRSGVLEPLEERFTEALTWSLQCYDAQVRRRLVPLLRRHRMALLTAPAVAAL
LLLFWSAAYGGDAQDQGVPPPYQDASKDVEVRVRDLLARMTLAEKVGQMTQIERIVASPQ
ALRDYYIGSLLSGGGSVPRKQATAAEWVTMVSDFQKACLSTRLGIPMIYGIDAVHGHNNV
YGATIFPHNVGLGATRDPNLVKRIGAATALEVRATGIQYAFAPCIAVCRDPRWGRCYESY
SEDHRIVQAMTELIPGLQGDVPQNFTSGMPFAAGKDKVAACAKHFVGDGGTQNGINENNT
IIDQQGLMSIHMPAYLDALRKGVSTVMISYSSWNGLKMHANHDLITGFLKGRLNFQGFTI
SDWEGIDRITSPPGANYSYSVQASILAGIDMIMVPNNYQNFITILTGHVNSGLIPMSRID
DAVTRILRVKFTMGLFENPMPDPSLADQLGKQEHRDLAREAVRKSLVLLKNGKPGDAPLL
PLPKKAARILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTVLDAVKAAVDPSTEVVFA
ESPDAEFVRSGGFSYAIVAVGEHPYTETKGDSMNLTIPDPGPSTVQTVCAAVRCVTVLIS
GRPVVIQPFLGAMDAVVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTWFRSVDQLPMNYGD
AHYDPLFPLGFGLTTQGKMYQN*

MALLTAPAVAALLLFFWSAAAQGVPPYKDASKDVEVRVRDLLARMTLAEKVGQMTQIERL
VASPQVLRDYYIGSLLSGGGSVPRKQATAAEWVAMVGDFQRACLSTRLGIPMIYGIDAVH
GHNNVYGATIFPHNVGLGATRDPNLVKRIGAATALEVRATGIQYAFAPCIAVCRDPRWGR
CYESYSEDRRLVQNMTELIPGLQGDVPQNFTSGMPFAAGKNKVAACAKHFVGDGGTHDGI
NENNTIIDRKGLMSIHMPAYLDALRKGVSTVMISYSSWNGLKMHANHNLITGFLKGEHKF
QGFTISDWEGIDRITSPPGANYSYSVQASILAGIDMIMVPNNYQDFITILTGHVNSGLIP
MSRIDDAVTRILRVKFTMGLFENPMPDPSLADQLGKQEHRDLAREAVRKSLVLLKNGKPG
DAPLLPLPKKAAKILVAGSHADNLGYQCGGWTIEWQGDTGRITVGTTLLDAVKAAVDPST
AVVFAENPDAGFVRNGGFSYAIVAVGEHPYTETKGDSMNLTIPEPGPSTIQTVCGAVPCA
TVLISGRPVVIQPFLGTVHALVAAWLPGSEGQGITDVLFGDYGFTGTLPRTWFKSVDQLP
MNYGDEHYDPLFPLGFGLTTQGKKGC*

Other information
Ka divergence:0.241408KaKs divergence:-0.999821
GC content 1 (%):67GC content 2 (%):66GC content divergence:-0.008
Length 1 (bp):2049Length 2 (bp):1881Length divergence:-0.043
MFE 1 (kcal):-992MFE 2 (kcal):-885.7MFE divergence-0.057