Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G017254-GRMZM5G830874
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279000
Function (paralog2):hypothetical protein LOC100276788

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.63764402688347
Log2 mRNA fold difference:-0.005833603054034
Log2 TE fold difference:-0.63238843263456
Sequences
Protein sequence

MSIEERKISMISKSTALNPNAEEFVPSSLRSFSDSSKKSDATMIVSGSSKESSTDKPESI
LRSNSDEEAHQYWQQQLPDDITPDFKVLGQDESPGPDSLSLTGLSINDGIDTSIFSPNQT
LGVQHHASPFIRDKLNTRPKINLSGPTYMDERSQAAILSPTAGSMSPNAAPWVKNLRNGG
HYNTSRRDATASHYNGDSSIGASLHNLTDAYHGSRRSLSTTMDIMSQLESKVDGRLNQNL
RSLSFGNSSPPSPASYAQNGLGNYSNEAFGLPNSPYRSHSAILADDIVSPSAGREHISLD
VPRGRYKTTSLPVPGLGSSRGSQVLGGPYNGNHDMISTNTLQNMAGIQTGAAWLETDAAA
NTYLESKDEVHDFASLRHAVLEQQDRQAFLMGNNPLAKDLTLKELYSIQSRLAQEKARET
TYRQRFQIPELQGLIQEQNPPIDLCGLHISEAMHVLNYELNNRRKIVRSTGRRLQAMIIS
SARTPARLTAAVEQYLMEHGLQYTQAQPGLFRVLL*

MSIEERKISVISKSIALNPNAEEFVPSSLRSVNDSSKRSYATTVVSGISKESSTDKPESI
LRSNSDEEAHQYWQQQLPDDITPDFKVMGQDESPGPDSLSLTDLSINDGIGTSIFSPNQT
LSMQHRASPFIRDKLNTHPKINLSIPTYMDERSQATILSPTAGSMSPNAAPWVKTLRNGG
HYNTSIRDASQYNGDSSIGASLHNLTDAYHGSRRSLSSTMDIMNQLESKVDGRRSQNLRS
LSFGNSSPTSPASYAQNGLGNYAGREHVSLDVPRGRYKTTSLPVPGLGSSRGYQLLGGSY
NGNHDMISTNTPQNMAGIQTGPAWLESDAEASTYLESKDEVHDFASLRHAVLEQELYSIQ
SLLAQEKARETTYRQRLQTPQLQGLIQEQNPPIDLCGLHISEAIHVLNYELNNRRKIVRS
TGRRLQVMIISSARTPARLTAAVEQYLMEHGLLYTQVQPGLLRILL*

Other information
Ka divergence:0.863366KaKs divergence:0.954318
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1548Length 2 (bp):1401Length divergence:-0.05
MFE 1 (kcal):-462.1MFE 2 (kcal):-415.5MFE divergence-0.053