Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G017400-GRMZM2G022611
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7468725074784
Log2 mRNA fold difference:-0.73971775909874
Log2 TE fold difference:-1.0880264336354
Sequences
Protein sequence

MDDDIDSSCSTPFASAPSSPGRPQALGGGGGYFFSAPASPIHHLLLSTSCSASATPSSGV
RGCGGDAEFEFGGPGGPMISADELFHNGQIRPLTLPPLPDLDPGSDDNEGRAPTRGRDLT
PRSASVHRRARSMSPLRSASPRLKLINALVVPAPDLGPGPDATGTHGEAAPPVTASSRSS
SSSSTSSSSSSGTSSARGSRRWVFIRDMLLHRSKSEPGSGAHAHDVPGAPAANKPERAWP
FSSPSWVTRDRLAARLRPSRAPPATENACGLGGEDGRPRGQGRGRGRGRRRRSTTVAAAH
ERLYAAPNRAQAEEMRRRTFLPYRQGLLGCLGFSSRGYGALHGLTKTLNPVFSR*

MDDDIDSSCSTPFASAPSSPGRPHAIGGGGYFFSAPASPIHHLLLSTSCSASATPSTGGR
GCVGDAEFEFGGPGGPMISADELFHNGQIRPLTLPPLPDLDPGSDDDEDCGRAPTRGRDL
TPRSASVHRRARSMSPLRSASPRLKLMNALVPAPDLGPAPDATGEAAPPVTASSRSSSSS
STSSSGTSWVRGSRRWVFIRDMLLHRSKSEPGSSAHSRDALGAPAAGANKPERTSWPFSP
SWVARDRLAARLRPSRSPPATEAAGEDARPRGQRRGRRRRSTTVAAAHERLYAAPNRAQA
EGMRRRTFLPYRQGLLGCLGFSSRGYGALHGFTKTLNPVFSR*

Other information
Ka divergence:0.237015KaKs divergence:0.256917
GC content 1 (%):73GC content 2 (%):73GC content divergence:0
Length 1 (bp):1065Length 2 (bp):1029Length divergence:-0.017
MFE 1 (kcal):-544.14MFE 2 (kcal):-515.4MFE divergence-0.027