Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G017792-GRMZM2G053987
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272353
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.47336599049158
Log2 mRNA fold difference:-0.28863927749582
Log2 TE fold difference:-0.1604740626657
Sequences
Protein sequence

MSSAGGMDGSPPVAEFQPTVTHGGRFLRYNIFGNLFEITRKYQPPVMPIGRGAYGIVCSV
MNFETREMVAIKKIANAFDNHMDAKRTLREIKLMRHLDHENIIGIRDVIPPPIPRAFNDV
YIGMEFMETDLHQIIRSGQELSEEHCQYFLYQILRGLKYIHSAGVIHRDLKPSNLLLSAN
CDLKICDFGLARPSSDSDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELIDR
RPLFPGRDHMHQMRLITEVIGTPTDDELGFTRNEDARKYMRHLPQFPRRPFASLFPRVQP
LALDLIERMLTFNPLQRITVAEALAHPYLERLHDVDDEPVCTEPFSFDFERQALTEDQMK
QLIFNEAIELNPSFRY*

MSGGGVDGAPVAEFRQTVTHGGRFLQYNIFGNLFEITHKYQPPIMPIGRGAYGIVCSVMN
SETKEMVAIKKIANAFDNHMDAKRTLREIKLLRHLDHENIIGIRDVIPPPVPQAFNDVYI
GTELMDTDLHHIIRSNQELSEEHSQYFMYQILRGLKYIHSANVIHRDLKPSNLLVNANCD
LKICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQP
LFPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQFPRRPFVSLFPRMQPVA
LDLIERMLTFNPLQRITVEEALEHPYLERLHDVADEPICTDPFSFDFEQQALTEDQMKQL
IFNEAIELNPNFRY*

www.000webhost.com

Other information
Ka divergence:-0.1509KaKs divergence:0.133401
GC content 1 (%):63GC content 2 (%):62GC content divergence:-0.008
Length 1 (bp):1131Length 2 (bp):1125Length divergence:-0.003
MFE 1 (kcal):-471.84MFE 2 (kcal):-447.86MFE divergence-0.026