Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G017868-GRMZM2G032163
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.5629328590435
Log2 mRNA fold difference:-2.5769271749669
Log2 TE fold difference:4.1271979769056
Sequences
Protein sequence

MAAAPGAPEERLGVLTPQCLREKTGISEPRSEVHRDGNYHRAVNVWIYSESTGELLLQRR
ADCEELWPGQ*

MAAAPEERLDVLNAAGDKIGVSKPRSEVHRDGDYHRAVHVWIYSESTGELLLQRRADCKD
SWPGQWDISSAGHISAGESSLFSAQRELEEELGINLPVDAFELIFVFLQECVINNGTYTN
NEYNDVYLVTTLTPIPLEAFTLQESEVSAVRYMRCDEYKSCLAKESREYVPYDVNGQYGQ
LFSIIEERYKENTESQSLTLQKQMNRYVPIHLEPDLTSLSEGDREALGYILKAAIVIDDI
FYEQVWNSNKMLRDWLKGHSEFSPFDKLKWAYYSINKSTWSCLDENKAFLSTADSAVQLL
TEATKPVSGWKGIEYRAAFPLHKPPGANFYPPDMDKAEFELWKSKLTDKEQNDATGFFTV
IKRHDSLSSSSLTQSDGSDQTKTKDDLFIVPYSKEYRPFLEKAAELLEKASACSDSPSLK
NLLRTKANAFLSNDYYESDIAWMELDSNLDLTIGPYETYEDSLFSYKATFEAFVGIRDDT
ATSQVKLFGDQLQDLEKNLPMDNIFKSDSISAAPIRVINLLYNAGDVKGPQTIAFNLPND
ERIVNERGTSMVMLKNISEAKFKHILKPIADACIREEQKEYVDFEPYYTHIVCHECCHGI
GPHSITLPSGKKTTVRRELQEFHSALEEAKADIVGLWALNFLIKKGLLPKSLSQSMYVSF
LAGCFRSIRFGLEEAHGKGQALQFNWLYEKGAFVLQSDGKFSVDFTMVEDAVESLSREIL
TIQAKGDKPSAQSLLQSRATLTQPLRMALERIEHMQVPVDIAPVFSTANKLFADI*

Other information
Ka divergence:-0.63934KaKs divergence:0.581515
GC content 1 (%):64GC content 2 (%):44GC content divergence:-0.185
Length 1 (bp):213Length 2 (bp):2328Length divergence:0.832
MFE 1 (kcal):-88.4MFE 2 (kcal):-715.1MFE divergence0.78