Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G018099-GRMZM2G450512
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100275815

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.5245681625824
Log2 mRNA fold difference:8.0542459521289
Log2 TE fold difference:-6.5048542219147
Sequences
Protein sequence

MASRAQRKMTIVCLMLLAVVGQIIVGMAVEHPNPSNICTETVIDPRVPNNECICSKNCAC
AGKCILESADAVQTCFVDCVLKNDCICSSKIIPGADDPKANAK*

MASAAQKKMTIVCLMLLAVVGQIVADDDVTVEHPSRICTETVIDPRVPNNVCICSKNCAC
AGKCILESADAVQTCFVDCVLKNDCICSNKIIPGADDPKANAK*

Other information
Ka divergence:0.537027KaKs divergence:-0.996178
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):312Length 2 (bp):312Length divergence:0
MFE 1 (kcal):-95.24MFE 2 (kcal):-100.2MFE divergence0.025