Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G018487-GRMZM2G147880
Species:maize
Duplication type:WGD
Function (paralog1):Protein WRKY1 (WRKY DNA-binding protein 1)
Function (paralog2):WRKY transcription factor 21

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.073533346089255
Log2 mRNA fold difference:0.08949280213324
Log2 TE fold difference:0.045023241029998
Sequences
Protein sequence

MEGMEEANRTAVESCHRVLALLSNPHGQLVPSKELVAATGEAVAKFGSLTAKLSNSNGDG
LLQGHARVRKVKKPLHIFDSNLFLESSAVAAAAAPAKTPSPSPILGLQLFPRYHQFEGSS
SKDPVRIPTQFPKRLLLEKPTAGMEGSTSQSPPIVQMVQPVSVAPPAGTPTPALPPAHLH
FIQQQQSYQRFQLMQQMKIQSEMMKRSNLGDQGGSLSGGGGGGRKGVNLKFDSSNCTASS
SRSFLSSLSMEGSLASLDGSRTSRPFQLLSGSQTASTPELGLVQRRRCAGREDGTGRCAT
GSRCHCSKKRKLRIRRSIKVPAISNKVADIPADEFSWRKYGQKPIKGSPHPRGYYKCSSV
RGCPARKHVERCVDDPSMLIVTYEGDHNHNRVLAQPA*

MEAMEEANRTAVESCHRVLALLSNPHGQLVPSRELVATTGEAVARFGSLAAKLSSSNGNG
LQGHARVRKTKKPLPIFYSNLFLESSSAVAAAATVAKTPSPSPTTGLQLFPRYHQMEGSS
CKDPVRIPAQFPKRLLLENLAAGLEGSSPPAPPVRMVQPVSVAPPAGMPTPALPAAHLHF
IQQQQSYQRFQLMQQMKIQSEMVKRSNLGEQGGSLSGGGGGGKGVNLKFDSSNCTASSSR
SFLSSLSMEGSLASLDGSRASRPFQLVSGSQTSSTPELGLVQRRRCAGKEDGSGQCATGS
RCHCSKKRKLRIRRSIKVPAVSNKVADIPADEFSWRKYGQKPIKGSPHPRGYYKCSSVRG
CPARKHVERCVDDPSMLIVTYEGDHNHSRVLAQPA*

Other information
Ka divergence:0.257053KaKs divergence:-0.211153
GC content 1 (%):60GC content 2 (%):61GC content divergence:0.008
Length 1 (bp):1194Length 2 (bp):1188Length divergence:-0.003
MFE 1 (kcal):-491.3MFE 2 (kcal):-522.3MFE divergence0.031