Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G018508-GRMZM5G864266
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193936
Function (paralog2):hypothetical protein LOC100383827

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.36531400011553
Log2 mRNA fold difference:-0.80087726303998
Log2 TE fold difference:0.42797030511339
Sequences
Protein sequence

MYLDVADSGVLPYGWTRYAQFSLSVVNQIHNKFTIRKETQHQFSARESDWGFTSFMPLGE
LYNHSRGYLVNDTCIVEAEVAVCKVVDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYH
IPYFRKAVYHMPTTENDMPSGSIPLALQSLFYKLQYNDSSVSTKELTKSFGWDMHDSFMQ
HDVQELNRVLSEKLEDKMKGTVVEGTIQQLFEGHHMNYIECINVDFKSTRKESFYDLQLD
VKGCQDVYASFDKYVEVEQLEGDNKYHADKHGLQDAKKGVLFIDFPPVLQLQLKRFEYDF
MRDTMVKINDRYEFPLQLDLDRDDGKYLSPDADRNVRNLYTLHSVLVHSGGVHGGHYYAF
IRPTLSDQWFKFDDERVTKEDAKRALEEQYGGEEELPQTNPGLNNTPFKFTKYSNAYMLV
YIRESDKDKIICNVDEKDIAEHLRIRLEKDREEKERRKKEKAEAHLYTIIKVARDDDLKT
QIGKDIYFDLVDHDKVPSFRIQKQMAFAQFKEEVAKEFGIPTQFQRFWLWAKRQNHTYRP
NRPLCPQDEAHTVGQLKELVNKAHNAELKLFLEVELGLDLKPLPLPDKTREDIFLLFKLY
EPEKEQLRYVGRLFVKASGRPQDILPKLKMLAGFSQDDDIELYEEIKFEPNVMCEYIDNR
LLFRSCQLEDGDIICFQKSSKADSADRYRFPDVPSFLTYIRNRQVVHFRSLEKPKEDDFF
LEMSKIFTYDQVVEKVAEKLGVDDPSKIRLTSHNCYSQQPKPQPIKYRGVERLLDMLIHY
NQTSDILYYEVLDIPLPELQALKTLKVTYHHATKDEVSVHSIRLPKNSTVGDVLNDIKTK
VELSHPNAELRLLEVFYHKIYKVFAPNEKIENINDQYWTLRAEEVPDEEKNLGPFDRLIH
VYHFTKDTQNQTQVQNFGEPFFMVIREDETLSSIKERIQRKLKVPDEDFSKWKFAYISLG
RPDYFEDSDTVALKFQRNMYGAWEQYLGLEHPDTAPRKAHTINQNRHSFERPVKIYN*

MTTSPPPAEQEQQEEEEVLVPHGPHQELPNGAQPMEVVPAEPAATVENQQIEDPPISRFT
WTIENLSRVSTKKLYSEIFVVGGYKWRILIFPRGNNVEFLSMYLDVADSGVLPYGWTRYA
QFSLSVVNQIHNKFTIRKETQHQFSARESDWGFTSFMPLGELYNPSRGYLVNDTCIVEAE
VAVCKVVEYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKIQLTTDISCQAVY
HMPTTENDMPSGSIPLALQSLFYKLQYNDSSVSTKELTKSFGWDMHDSFMQHDVQELNRV
LSEKLEDKMKGTVVEGTIQQLFEGHHMNYIEYLQLDVKGCQDVYASFDKYVEVERLEGDN
KYHADKHGLQVLEPSEASMDHNGRQHAHRYWMSSIPCRCVKDAKKGVLFIDFPPVLQLQL
KRFEYDFMRDTMVKINDRYEFPLQLDLDRDNGKYLSPDADRNVRNLYTLHSLLDVDDILA
IKAIRCVVVDLIDSHAHNDYSYSVLVHSGGVHGGHYYAFIRPTLSDQWFKFDDERVTKED
AKRALEEQYGGEEELPQTNPGLNNTPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIAE
HLRIRLENDREEKERRKKEKAEAHLYTIIKVARDDDLKAQIGKDIYFDLVDHDKVPSFRI
QKQMTFAQFKEEVAKEFGIPTQFQRFWLWAKRQNHTYRPNRPLCPQDEAHTVGQLKELVN
KAHNAELKLFLEVELGLDLKPLPLPDKTREDIFLFFKLYEPEKEQLRYVGRLFVKASGRP
QDILLKLRMLAGFSQDDDIELYEEIKFEPNVMCEYIDNRLLFRSCQLEDGDIICFQKPSK
PDSADRYRFPDVPSFLTYIRNRQVVHFRSLEKPKDDEFCLEMSKIFTYDQVVEKVAEKLG
VDDPSKIRLTSHNCYSQQPKPQPIKYRGVERLLDMLIHYNQTSDILYYEVLDIPLPELQA
LKTLKVTYHHATKDEVSVHSIRLPKNSTVGDVLNDIKTKVELSHTNAELRLLEVFYHKIY
KVFAPNEKIENINDQYWTLRAEEVPEEEKNLGPFDRLIHVYHFTKDTQNQTQVQNFGEPF
FMVIREDETLSSIKERIQKKLKVPDEDFSKWKFAYISLGRPDYFEDSDTVALKFQRNMYG
AWEQYLGLEHPDTAPRKAHTANQNRHSFERPVKIYN*

www.000webhost.com

Other information
Ka divergence:0.0396902KaKs divergence:-0.999935
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):3054Length 2 (bp):3531Length divergence:0.072
MFE 1 (kcal):-860.56MFE 2 (kcal):-1010.58MFE divergence0.08