Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G018566-GRMZM2G120857
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191841
Function (paralog2):3-isopropylmalate dehydrogenase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.57931415019718
Log2 mRNA fold difference:0.41541116420932
Log2 TE fold difference:0.14125187353452
Sequences
Protein sequence

MALRRLLQGSVLPRVTGRVSAPAVAPFSTESGETIRATLFPGDGIGPEIAESVKQVFNVA
GVPIEWEEHYVGTEVDPRTESFLTWESLESVRRNKVGLKGPMATPIGKGHRSLNLTLRKE
LGLYANVRPCNSLPGYKTRYDDVNLVTIRENTEGEYSGLEHQVVRGVVESLKIITRQASL
RVAEYAFHYAKANGRERVSAIHKANIMRKTDGLFLKCCREVAETYPEIQYEEVIIDNCCM
TLVKNPGLFDVLVMPNLYGDIISDLCAGLIGGLGLTPSCNIGEGGICLAEAVHGSAPDIA
GKNLANPTALMLSAVMMLRHLQFNDKADRIHNAILQTIAGGKYRTADLGGKASTSEFTNA
VCDHI*

MPGRSLPSTTTTLLSSASPFTIVSPLVRPPRRRRRPPPPLPLPLRTLCESSLSGLCGAGM
ALRRLLQGSVLPRIIGRDLAPAVAPFSTESGETIRATLFPGDGIGPEIAESVKQVFNVAG
VPIEWEEHYVGTEVDPRTESFLTWESLESVRRNKVGLKGPMATPIGKGHRSLNLTLRKEL
GLYANVRPCNSLPGYKTRYDDVNLVTIRENTEGEYSGLEHQVVRGVVESLKIITRQASLR
VAEYAFHYAKANGRERVSAIHKANIMRKTDGLFLKCCREVSEKYPEIQYEEVIIDNCCMT
LVKNPGLFDVLVMPNLYGDIISDLCAGLIGGLGLTPSCNIGEGGICLAEAVHGSAPDIAG
KNLANPTALMLSAVMLLRHMQFNDKADRIHNAILQTIAEGKYRTADLGGKASTSEFTNAV
CDHI*

Other information
Ka divergence:0.367569KaKs divergence:0.59444
GC content 1 (%):48GC content 2 (%):50GC content divergence:0.02
Length 1 (bp):1098Length 2 (bp):1275Length divergence:0.075
MFE 1 (kcal):-378.8MFE 2 (kcal):-439.1MFE divergence0.074