Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G018869-GRMZM2G060061
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):xylosyltransferase 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.34150489654309
Log2 mRNA fold difference:-0.17520382044174
Log2 TE fold difference:0.50124611012641
Sequences
Protein sequence

MGAADKWLLPLVSVSVVSLLLFLSALSGFSASSALFARLPPPSYVRRGAAAPPSFAYLLA
GGRGDGRKLLRLLLAVYHPRNRYLLHLSADAPDSERAELAAAAARAAPAARAFGNVDVVG
RPTAGTPMGSSGLAATLRAAAAMLRLDAEWDWFITLSAADYPLLTQDDLIHVFSSVPRHL
NFIDHTSDIGWKESQRVQPVIVDAGIYLAGRNQFFQATEKRDTPDGFKFFTGSPWVILNR
HFVEYCVFGWENLPRTLLMYFTNVMLPLEGYFHSVACNSDFHNFTVNNDLRYVVWDDPPQ
MEPHFLNVTHYDELVGTGVPFARKFKEDEPLLDMIDDKVLRRWRHRPVPGAWCTGKRRWF
SDPCSQWSNVNIVRPGPQAEKFRTYINQIMEESKSSNNSCKQ*

MGAADKWLLPLVSVSFVSLLLFLSALSGFSASSALFARLPPPSYVRRGAAAPPSFAYLLA
GGRGDGRKLLRLLLAVYHPRNRYLLHLSADAPASERAELAAAVARAAPAVRAFSNVDVVG
RPTAGTPMGSSGLAATLRAAAAMLRLDAEWDWFITLNAADYPLLTQDDLIHVFSSVPRHL
NFIDHTSDIGWKESQRVQPIIVDAGVYLAGRNQFFQATEKRDTPDSFKFFTGSPWVILNR
RFVEYCIFGWENLPRTLLMYLTNVMLPLEGYFHSVACNSDFRNFTVNNDLRYMIWDNPPQ
MEPHFLNVTHYDELVGTGVPFARKFKENEPLLDKIDDQVLRRWHQRPVPGAWCTGRRRWF
SDPCSQWSNVNIVRPGPQAEKFRTYINQIMEESKSGNNSCKQ*

Other information
Ka divergence:-0.0455158KaKs divergence:-0.0386507
GC content 1 (%):57GC content 2 (%):57GC content divergence:0
Length 1 (bp):1209Length 2 (bp):1209Length divergence:0
MFE 1 (kcal):-450MFE 2 (kcal):-458.3MFE divergence0.009