Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G018941-GRMZM2G051613
Species:maize
Duplication type:WGD
Function (paralog1):NADH-ubiquinone oxidoreductase 13 kDa-B subunit
Function (paralog2):NADH-ubiquinone oxidoreductase 13 kDa-B subunit

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-3.0814856939549
Log2 mRNA fold difference:-4.1563565768895
Log2 TE fold difference:1.0725299133215
Sequences
Protein sequence

MFLRRILTGGGGLAALRAARAVKETTGIVGLEVVPNAREVLVGLYERTLKEIKAVPEDEG
YRKAVESFTGHRLQICQEEEDWKRIEDRIGCGQVEELIEEAEDELKLIAKMIEWDPWGVP
DDYECEVIEDDTPIPKHVPQHRPVALPEEFFKALDAVKSDPALQGDAPPQVKA*

MTQRHQLSSIQQPSSLVPAHQQRDATTTTASDDGEMFLRRILTGGGGLAALRAARAVKET
TGIVGLEVAPNAREVLIGLYTRTLKEIEAVPKDEGYRKAVESFTNHRLQICQEEDDWKRI
EDRIGCGQVEELIEEAEDELKLIAKMIEWDPWGVPDDYECEVIEDDTPIPKHVPQHRPVA
LPEEFFKTLDAVKSDPALQGDAPPQVKA*

Other information
Ka divergence:-0.758741KaKs divergence:-0.822115
GC content 1 (%):59GC content 2 (%):60GC content divergence:0.008
Length 1 (bp):522Length 2 (bp):627Length divergence:0.091
MFE 1 (kcal):-218.79MFE 2 (kcal):-241.5MFE divergence0.049