Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G019050-GRMZM2G097043
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384829
Function (paralog2):hypothetical protein LOC100383560

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.7959882691617
Log2 mRNA fold difference:0.013803840314124
Log2 TE fold difference:0.77678954571471
Sequences
Protein sequence

MEPAGARKEWRAVPGSSLRSNGAEDAAEHGKLGQSEDRAIYEEGAGGLEDFCAITIDGSG
GLSEDILQQRLQSVVRQREQLQQVEMELRAQAIAHPQIIQAQQSFQATSKEHAAAVAKIK
QEQLHEREQYILELEMKLNDKDRELNALKIDHQTVWANQDLIREQTKELATVRRERDNSE
AERAQHLTQIHELQEHLREKESQFIALEEQHRAAQDNILYKDEQLREAHAWVSQVREMDA
LQSQSLQVELRERMEQFNQYWISSQQQYAEMQRSLLHTIQQLQQELTEAREQSGAQKDGP
QVSREGSAESSLVQSMGNSVASNGSATADGNQQLLKNNGSVDVSVQANSASAVPVPSSLL
GIGGPAAHIAAMHAFMIHPQGIPQPLVASPNSGVPQFGSFQSQSTIQPNSQWPNQQEVQN
VSQPQDETNYQTSQSDRTVLQQGAINTDELSSKPSQDSQPDHLNAHVKQQQSPASAPTES
THELTVVEANVAEHVSCDEQQKILNEQDSLSNMNNHIGIVEHLEQNTESKDERAASDKQP
EPVSRQHKHLNFPPFTTQIHLKKSATENPNVVNQVDIMKSVAGGFSSQLPRAPKEPSLLD
ERSLLACIVRAVPAGTEGGIRISSTLPNRLGKMLAPLHWHDYKKQYGKLDDFVASHPELF
VIEGDFIHLRDGAQQIISATTAAAKIAAATASSASYSSLLPSVAVTPVAQNTRQKRRPAV
DSRSSNAIPSGNGFTDQFNIIQGVSDVTISGKVRNIQDNGFIDEVRTGQPSVLTAATANG
ARHDKCANNTRHGYGGKQQGRTTGTTYLSRR*

MEPAGARKEWRAVPDSSLRSNGAEDAAEHGKLGQSEERAIYEEGAGGLGDFCTITIDGSG
GLSEDILQQRLQSVARQREELQQVEIELRAQAIAHPQIIEAQQSFQAAAKEHAAAVAKIK
EQLHEREQYILELEMKLNDKDRELNALKIDHQTVWANQDLLREQTKELASVRRERDNSEA
ERAQHLKQIHDLQELLREKESQFIAIEEQHRAAQENILYKDEQLREAHAWVSQVREMDAL
QSQSLQVELRERMEQFNQYWISSQQQYAEMQRSLLHTIQQLQQELAEARERSGAQKDGPH
VSREGSAESSLVQSIANSVTSNGSATADGSQQLLKNNGSVDVSLKGNNASAVPVPSLLGI
GGPAAHIAAMHSFMIHPQGIPQPLASPNSGIPQFGSFQTQPMIQPNSHWPNQQEVQIVSQ
PQDETNYQTSQSGQTALQQDTINTDELSPKASEGGHPDHLNAQGKQQQSPASAPTESTHE
LTVVETNIAEHVPYDEQQKTLKEQDSLSNIKSHVGRVEPQEQNAESKVERAASDKQSEPQ
SRQHKPSNFPPTTQLNLKNSATENPNVVNQVDTMKSVTGGFGSQLPRVPKEPALLDERSL
LACIVRAVPAGPEGGIRISSTLPNRLGKMLAPLHWHDYKKQYGKLDDFVASRPELFVIEG
DFIHLREGAQQIISATTAAAKIAAATASSAPYSSLLPSVAVTPVAQSTRQKRGPAVDSRS
SNAILSGNGFTDQFNIIQGVSDVPVSGKVRNTLDNGFLGEVRTGQPSVLTAAANGARHDK
GTNNVIQGYGGKQQGRSTGMAYLSRR*

Other information
Ka divergence:-0.0167285KaKs divergence:0.11047
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):2436Length 2 (bp):2421Length divergence:-0.003
MFE 1 (kcal):-777.87MFE 2 (kcal):-792.78MFE divergence0.009