Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G019260-GRMZM2G030839
Species:maize
Duplication type:WGD
Function (paralog1):Phosphomevalonate kinase
Function (paralog2):phosphomevalonate kinase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.6016731020106
Log2 mRNA fold difference:-0.2163389961212
Log2 TE fold difference:-1.4247536976651
Sequences
Protein sequence

MEVVASAPGKVLIAGGYLVLERPNAGLVLSTTARFYAVVRPLRDSLPADAWAWAWTDVKV
TSPQLSREATYKLSLTKSTLQLTSARESTNPFVEQAIQFSVAAAKATIIDKERKDVVDKL
LLQGLNITILGCNDFYSYRKQIEARGLPLTPEALLSLPPFSSITFNSEVANGTMTGEKCK
PEVAKTGLGSSAAMTTSVVAALLHYLGVVSLSCPGQSSGDNTTTRELDLVHSIAQSAHCI
AQGKIGSGFDVSAAVYGSQRYVRFSPEILSSQATGGTFLPDVVSDIVTQRWDHENKQFSL
PPLMTLLLGEPGTGGSSTPSMVGSVKRWQKSDSEKCKDTWSKLAFANSALENQLRILKGL
SENHREAYESVVLSCSHLTYEKWTEVATNQHQELIIKSLLAARDACLEIRLHMREMGIAA
GVPIEPDSQTRLLDATMNMEGVLLAGVPGAGGFDAVFSVTLGDASNAVANAWSSAGVLPL
LVREDCRGVSLEDADPRTREVSAAVSSIQIN*

MEVVASAPGKVLIAGGYLVLERPNAGLVLSTTARFYAVVRPLRDSLPADSWTWAWTDVKV
TSPQLSRVATYKLSLNKTTLQLTSSRESTNPFVEQAIQFSVAAAKATIIDKERKDVVDKL
LLQGLNITIIGHNDFYSYRKQIEARGLPLTPEVLLSLPPFSSITFNSEVANGTMTGEKCK
PEVAKTGLGSSAAMTTSVVAALLHYLGAVNLSCSGQSSGDNASGRELDLVHAIAQSAHCL
AQGKIGSGFDVSAAVYGSQRYVRFSPEILSSAQAIGGTVLPDVVSDVLTQRWDHENKQFS
LPPLMTLLLGEPGTGGSSTPSMVGSVKRWLKSDPEKSRDTWSKLAIANSTLENQLRILKG
LSENHHEAYESMVRSCSRLTYGKWAEVATNQHQELIIRSLLAARDACLEIRLHMREMGIA
AGVPIEPDSQTRLLDATMNMEGVLLAGVPGAGGFDAVFSVVLGDASNAVAHAWSSVGVLP
LPVREDCRGVSLEDADPRTREVSAAVWSIQIN*

Other information
Ka divergence:0.251313KaKs divergence:0.362789
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1536Length 2 (bp):1539Length divergence:0.001
MFE 1 (kcal):-526.9MFE 2 (kcal):-525.52MFE divergence-0.001