Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G019500-GRMZM2G142757
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384082 (LOC100384082), mRNA
Function (paralog2):hypothetical protein LOC100216721

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.78422437114154
Log2 mRNA fold difference:1.2479261039688
Log2 TE fold difference:-0.46107192176333
Sequences
Protein sequence

MASFFADDGADDLPRATSHPFDSDDFGAAAADDASAGGYASFADGGVEEVDEEITVESYG
VPIRHVSGGYSPFSPDLEPNGSDGPTLPPPTEMGREEGILLREWRRKNAMELEKKEQKEK
ELRAQIIAEAEEFKKAFFEKRIQNCASNMVNNREREKIFVASQEKFHANADKQYWKSISD
LIPHEIATIEKRGKKDKDKKPSVTVIQGPKPGKPTDLSRMRHILVKLKHAPPPHMLQPPP
APAAKEGAKDGSKEGGKDGGAKDGAAAPANDAKQPAESQETSTANGPSEAEKEQPAASE*

MRPHPPTPPPVTSQVHQAGPRISASPSPTMASFFADDGTDDLPRTTSHPFDSDDFGAAAA
DVAAADGYGGYASFAEGGVEEVDEEITVESDGVPIRHVSGGYSPSPFSPELEPNGGDGPI
LPPPTEMGRDEGILLREWRRKNAMELEKKEQKERELRAQIIAEAEEFKKAFFEKRIQNCA
SNMVNNREREKIFVASQEKFHAGADKQYWKSISDLIPHEIATIEKRGKKDKDKKPSITVV
QGPKPGKPTDLSRMRHILVKLKHAPPPHMLQPPPPAPAAKEGTKDGSAKGGGKDGAKEGG
AAAPANGAKQPAESQETTANGPSEAEKEQPAASE*

Other information
Ka divergence:-0.0454372KaKs divergence:-0.168467
GC content 1 (%):58GC content 2 (%):61GC content divergence:0.025
Length 1 (bp):900Length 2 (bp):1005Length divergence:0.055
MFE 1 (kcal):-334.51MFE 2 (kcal):-387.8MFE divergence0.074