Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G019807-GRMZM2G143469
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282478
Function (paralog2):LOC100285714

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.24237803209379
Log2 mRNA fold difference:-0.38278693039879
Log2 TE fold difference:0.17778867879301
Sequences
Protein sequence

MSLAPSIPSIKVKVGAVSVAPPHRACRSFAVIRSSKAEGPIRRPAAPPLSPPPPMPPKTP
ALSTPPTLSQPPTPVKPAAPPTSSQPMPPSPEPKPVDATAQMRKPVAGAMTLEYQRKVAK
DLQEYFKKKKLEEADQGPFFGFLPKNEISNGRWAMFGFAVGMLTEYATGSDFVQQMKILL
SNFGIVDLD*

MSLAPSIPSIKVKVGPVSVAPPHRACRSFAVVRSSKAEGPIRRPAAPPLSPPPKTPALST
PPTLSQPPKPAAPPTSSESTPPSPQPKAAVATAPAAALQRPLAGAVTLEYQRKVAKDLQD
YFKKKKLDEADQGPFFGFVPKNEISNGRWAMFGFAVGMLTEYATGSDFVQQLKILLSNFG
IVDLD*

Other information
Ka divergence:0.308455KaKs divergence:0.418133
GC content 1 (%):60GC content 2 (%):62GC content divergence:0.016
Length 1 (bp):570Length 2 (bp):558Length divergence:-0.011
MFE 1 (kcal):-225.72MFE 2 (kcal):-236.9MFE divergence0.024