Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G019872-GRMZM2G099642
Species:maize
Duplication type:TD
Function (paralog1):NADP-dependent oxidoreductase P2
Function (paralog2):hypothetical protein LOC100384694 (LOC100384694), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.61228791998016
Log2 mRNA fold difference:-1.1688774705632
Log2 TE fold difference:0.53018295309666
Sequences
Protein sequence

MEVVNRYVATRHHIEGAPTEADFEVKEEMARWAPDSGEVLVRNLYLSIDPYQLNRMKRSS
VTHLAVEGILPGQAASTLLSPSPSVKRITTYAAGEVVASACEEYKAGDKVAGVLGWEDYT
LFKPSPAVVMSKVADDAAGFPLSHHINVLGTSGMTAYGGFFEVCKPVKGEKVFVSAASGS
VGSLVGQFAKLAGCYVVGCAGTAAKVDLLKGKLGFDDAFNYKEEPDLKSALKRYFPDGID
IYFENVGGEMLEAALANMNPYGRVALSGVISEYTGGARRAVPDLLEVIYKRITIRGFFAY
DFLSKFAEFNAVIGGWVRDGKVQVLEDVSDGLESVPSAFAALFRGQNVGKKLVKLA*

MEVVNRYVATRHHIEGAPTEADFEVKEETARWAPDSGEVLVRNLYLSIDPYQLNRMKRSS
ASHLAVDGILPGQRIAAYAAGEVVASACEEYKVGDVVAGVLGWEDYTLFKPSPAVLMSKV
ADADAAGFPLSHHISVLGTSGMTAYGGLFEVGKPVKGEKVFVSAASGSVGSLVGQFAKLA
GCYVVGCAGTTAKVDLLKDKLGFDDAFNYKEEPDLKSALKRYFPDGIDIYFENVGGEMLE
AALANMNTYGRVALSGVISEYTGGGRRAVPDLLEVIYKRITIRGFFAWDFLPRFAEFNAV
IGGWVRDGKVQVLEDVSDGLESVPSAFAALFRGQNVGKKLVKLA*

www.000webhost.com

Other information
Ka divergence:-0.905534KaKs divergence:-0.927804
GC content 1 (%):64GC content 2 (%):66GC content divergence:0.015
Length 1 (bp):1071Length 2 (bp):1035Length divergence:-0.017
MFE 1 (kcal):-513.29MFE 2 (kcal):-515.06MFE divergence0.002