Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G019879-GRMZM2G048494
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100279518

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.0556678845514
Log2 mRNA fold difference:1.418973298227
Log2 TE fold difference:-0.37285731976498
Sequences
Protein sequence

MAGGGGERDADEETRNQMMQNLFGDQSEDEDDADDDGQQQQLQSPPHHHHEIEDDGDEDG
DDARSDAPARHGGYHSEEVDGEAENGGEGEGESEGQVEMEEESEGEAHRADLDQGESDGD
KVHSSPERELDDQRMESDAKGLDSEDEGYQQRTVSSRRRGVVASESEGSEDNYYADGAQE
DEEPRQTRKQSSPMEEERDHEVVRDVFGDSDEDEPAPYRSRHEIDEESHRSPMEDEDQYE
KDMQPDDTVADEDMRYESDENRELKPKEKPVGPPLDLVVPFKQPPARPDKMNVIKVSNIM
GIDPKPFDPKTYVEEDVFVTDESGTKKRIRLEDNIVRWRTIRNADGTTSCESNARFVKWK
DGSMQLLIGNEVLDISVHEAHHDQSHLFLRHGKGILQSQGRLLHKMQFMPSSLFSKSHRL
LTALVDSQNKKTVKMQKWFETKDPEKAKMEKERIQGQNIRAHSILQRKREKVNRKYTQPA
RPRRQLSPGFLEDALDEDEEPDYGSRRMPGRRRFEDELEAEALAERRIINAKKSNMSRNV
PRKPPYPPARLPRRQADEYSESEREESEYETDGEDIEHSPPRGREDELDEEEEYEEEVEE
EAPLSDEEMEMQAPKRKRESGGGGGHMREELASEDDESPPRKQPTVQHRRKAVVFDDSDE
D*

MAGGDRERDADEETRNQMMQNLFGDQSEDEDDADDDDVAEMVDEDDGHQPQSPPQSPPQR
HQELDDDAYDDEEEDARSHAPARASGYHSEEVDGEAENGGEGEGESEGQVVIEEESEGEA
HGADLDQGESDGDKVQSSPERELDDQRMEPDARGMDSEDEGYQQRTVSGRRRGVIASESE
GSEDSYYAAGAQEDEEPRQTRKQSSPLEEERDHEVVRDVFGDSDEDEPAPYRVRHEIDED
SHRSHMEDEGHYEKDMQPDDVVADEDMRYESDDNRELKPKEKPVGPPLDLVVPFKQPPAR
PDKMNVIKVSNIMGIDPKPFDPKTYVEEDVFVTDESGTKKRIRLEDNIVRWRTIRNADGT
TSCESNARFVKWKDGTMQLLIGNEVLDISVHEAHHDQSHLFLRHGKGILQSQGRLLHKMR
FMPSSLSSKSHRLLTALVDSQNKKTVKMQKWFETKDPEKAKMEKERVLGQNIRAHSILQR
KREKVNRKYTQPARPRRQLSPGFLEDALDEDDEPGYDSRRMPGRRRFEDELEAEALAERR
IINAKKSNMSRNVPHKPPYPPARPPRRQADEYSGSEREESEYETDGEDIEHSLPRGRRED
ELDEEEEYEEDVEEEEAPLSDEEMEAPKRKRESGGGGQRREELVSEEDDEDHDDSPPRKQ
PAVSHRRKAVVFDDSDED*

Other information
Ka divergence:-0.141639KaKs divergence:-0.0205842
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):1986Length 2 (bp):2037Length divergence:0.013
MFE 1 (kcal):-626.22MFE 2 (kcal):-669MFE divergence0.033