Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G019919-GRMZM2G126665
Species:maize
Duplication type:WGD
Function (paralog1):RNA recognition water-stress protein1
Function (paralog2):hypothetical protein LOC100216781

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.2346349249647
Log2 mRNA fold difference:-0.87352905170424
Log2 TE fold difference:-0.36314753825315
Sequences
Protein sequence

MPPKSKRGGAAAARKAPVTRGRMGRAQAAAEAAPVVEEMEAPAEEVKAAEEVPKVVEAPK
VVEDSKVVEEPKPSPLLPQQPVVVVEKDSDIAANGANQGEDDRAAKEIYEEEDKGERLEF
EDEPEYEEEAAVDYDEKDLEQYEEQYEDGDEEVEYTEDVVEVETDMVDEELDEGGDDVEG
EGYENADEDHHVDGDDEEHNEMVKEHRKRKEFEIFVGGLDKDATENDLMKVFGEVGEITE
VRLMMNPVTKKNKGFAFLRYATVEQARRAVSELKNPLVRGKQCGVAPSHDNDTLFVGNIC
KTWTKEHLKDKLKSYGVESFDDLLLAEDTNNPGMNRGYALLEFSTRPEAMDAFRTLQKRD
VVFGVDRSAKVSFADSYPQVDDEIMAQVRTVFLDGLPPSWDEDRVKKYLKKYGAIEKVEL
ARNMPAAKRKDFGFVTFDTHDNAVACTEGMSNSEIGEGEHKAKVRARLSRPLQRPPRMKH
GLRGNFRVGHGAPRGGRLPYSRAPPPRRPPPRLIRPAVSRLPSIRSHPLKRPIDIRDRRP
AMSMPDRARRFPPERSYDRRPPAPVYLKRSPRREYGRRDELPPPRSRATTDYITRVPVDR
RPSLRDDYSPRGSGYSDLGPRSAPRLSDRRAYADDSYGEKFDRPLVAYREGRGRDYDTIS
GSKRPYADMDDVPRYQEIGVRQSKARLDYDIGGSSARYGDTYSERSGRPHAGYSSSRSIP
VHDSAYGSSRHGMSYGGSASSADAGGMYPPSYSGSYGSRGSDVGGSSYSSLYSGRNLGTS
SGGYYGGSGSSSYY*

MEKLGLARNMPAAKRKDFGFVTFDTHDNAVACAEGISNSEIGEGDHKAKVRARLSRPLQR
PPRMKHGLRGNFRVGHGAPRGGRLQYARAPPPRRPPPRLVRPAGSRLPPIRSHPLKRPIY
IRDRRPAMPMLDRARRLPPSGRSYDRRPPAPVYLKKSPRREYGRRDELPPPRSRAMIDYS
PRVPVDRRPSLRDDYLPRGSGYSDLGPHSAPHLSDRRAYADDSYGGKFDRPLPVYREGRG
HDYDTVSGSKRPYADMDDAPRYQEIGVRQSKARLDYDIGGSSARYGDTYNERPGRPHAGY
SSSRSIPGHDSAYGSSRNGMSYGGSASSADAGGMYPPSYSGSYGSRGSDVGGSSYSSLYS
GRNLGSSSGGYYGGSGSGSYY*

www.000webhost.com

Other information
Ka divergence:0.0635873KaKs divergence:-0.152105
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):2385Length 2 (bp):1146Length divergence:-0.351
MFE 1 (kcal):-819.77MFE 2 (kcal):-409.2MFE divergence-0.334