Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G019999-GRMZM2G163233
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100381970

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.6979481851934
Log2 mRNA fold difference:-1.9206940474953
Log2 TE fold difference:0.21104625311471
Sequences
Protein sequence

MDRAELTTEQVLKRDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEEILLYFDYS
ARPKLQNGTLPNGDASNSKSKLTSTHDVLRGLVDWLCSQLRNPTHPSCSIPTSIHCLSTL
LREPYVRTLFVQADGIKLLIPLISPASTQQSIQLLYETCLCIWLLSFYDAAVDYLSTTRV
MPRLVEVVKGSTKEKVVRVVVLSFRNLLAKGAFAAQMIDLGLPQMVQNLKAQAWTDEDLL
DALNQLEVGLKENLKKLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILR
VLMTIIDTSSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNA
LICVQRLFLGAKYASFLQA*

MPRRRRTRSSEELKAEDFVDSVLNFGGEEDGEEEKQEAGGDGQPAAEFKSKNLEAERKRR
GKLNRNILALRAVVPNITKMSKESTLSDAIDLIKRLQNQVLELQRQLADPPGEAWEKQGS
ASCSESFTATENMPYQGQIELVPLGPCKYHLRIFCKKAGVFTKVLEALCSYNAQVTSLNT
ITFYGYAESVFTIEVKGEQDVVMVELRSLLSNIVEGRHADGAWTALVMDRAELTTEQVLK
RDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEEVLLYFDYSARPKLRNGTLPNG
DASNSKSKLTSTHDVLRGLVNWLCSQLRNPTHPSCSIPTSIHCLSTSLREPYVRTLFVQA
DGIKLLIPLISPAATQQSIQLLYETCLCIWLLSFYDAAVDYLSTTRVMPRLVEVVKGSTK
EKVVRVAVLSFCNLLAKGAFAAQMIDLGLPQIVQNLKAQAWTDEDLLDALNQLEVGLKEN
LKKLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTT
ALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVQKNALLCVQRLFLGDLD
PENSWPF

Other information
Ka divergence:0.744662KaKs divergence:0.666667
GC content 1 (%):45GC content 2 (%):52GC content divergence:0.072
Length 1 (bp):1140Length 2 (bp):1821Length divergence:0.23
MFE 1 (kcal):-332.4MFE 2 (kcal):-648.13MFE divergence0.322