Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G020054-GRMZM2G089995
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278463 (LOC100278463), mRNA
Function (paralog2):ethylene-responsive transcription factor 4

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAPKRSSEERAAAEQEQPRLRGVRKRPWGRYAAEIRDPVRKARVWLGTFDTPEQAARAYD
AAARRLRGPRATTNYPGDVVREAPCTAPALAASASGSTESSSSSSSRDDGHPPPPLPTAP
SSLGLGLGLFPATVATQPCLFLDPAPVEREEGERERSCCSRSPPSVLAGLGFDFDLNLPP
PAEMVM*

MAPKRPVSAAAAAEQPRLRGVRKRPWGRYAAEIRDPVRKARVWLGTFDTPEQAARAYDAA
ARKLRGPGAATNYPAPEPTAEALAEAPAASGSGSAVVYESSSASASASSCSLPLAAPSLD
LSLALPAAAAAAEPYQLFADPAAAAAVTPALLHFLPPKSEEQQSYSGSSSLSSSSSSVVF
DAAPPVGLRLDLNLALPPAEMVM*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):75GC content 2 (%):75GC content divergence:0
Length 1 (bp):561Length 2 (bp):612Length divergence:0.043
MFE 1 (kcal):-314.1MFE 2 (kcal):-362.3MFE divergence0.071