Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G020091-AC214648.3
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282601
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLRGGTGMLGVVNFITFLISIPILGGGIWLASRANSTDCIRFLQWPIIVVGLVLMVVSLM
GFAGACYRQTWLLRLYLFAMFFVVLALLFFVVFAFAVTDRGAGQVVMSRRFPEYQLSDYG
GWLRDRVADPQYWATISACLRDGHACAGMRRLARDPNTGMLVPETPAMFYGRNLSPIQSG
CCKPPTSCAFTYMNETYWEQNPGVPTVTNDPDCSRWSNDQQMLCFQCDSCKAGVLAGIKK
SWRKVAVLNIVVLIILVIVYVAGCAAFRNAKRIDNDEPVGMARMTKSHPSRFQF*

MASPPLPGKDAAFGSGTTVRRPGRLRVMHPHVAELLRSPRRHARPAAAPQAKAQAPVPER
ARYACAFEDGGGVAAPGRLVWAKVRNHPWWPGQVFDAADASAVARARRRLRRAVLVAYFW
DRTFAWTDAAALLPLRAGFPRLAAVAPVAAAVDAALAEVARRVLAGLSCCCGGGGDNEAT
ASTQAIDNAGVRAGAPGAAVDAAFARRALQAEALLGYLSALATSPRAGGDRVDLAVAAAQ
LGALGRWKGSARGLPEYTVVHGIDDAVVAAPGRAKAKRRRPPSTGVDGPAPAKRRVSRNT
HIAATKGNAACDTGDYEALELEDLPLGTPAQQTPTPTRIGKLMSRAAQNMSLSPVVLRVR
ATAANGSNCAPPPPTAVLPAPHMVRCAVVAAHEQLPPTRKDDSGDHEAWAGAGLVLNFSS
AHAVPSARHLATAFSRFGPVKEVRVDNTTVVFDSDAHADEAFSGAAEIGSISASLVSFRV
TSSLPAAPDDPAAQPQTQSMPSDTSPVEALR*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):64GC content 2 (%):71GC content divergence:0.052
Length 1 (bp):885Length 2 (bp):1536Length divergence:0.269
MFE 1 (kcal):-368.4MFE 2 (kcal):-831.61MFE divergence0.386