Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G020140-GRMZM2G075528
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194180
Function (paralog2):hypothetical protein LOC100193527

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.82747391936025
Log2 mRNA fold difference:0.10243251924374
Log2 TE fold difference:-0.90879631616814
Sequences
Protein sequence

MMSGGGYSALDDPKASGSVPAATGTDPPAIRFADSNLQTFPPSEARGKISGAYRPPTDAD
DTFSSKGGGAGSGGRGGSAGLDDAAQGGWFRMFSVAAYKPYFDVDTSDVVERIWESVFPF
RGTFTEKTSENPDLYGPFWTCTTLIFVAASIATFVTYLSHKWHKKEWNYDINLVTWSAGL
FYGYVTFVPLLLYVILKYFSAPAGLVQLWCLYGYSLFIFIPASLLSIVPIEIFRWVIAGV
AGFMSATFVAVNLRAHIVNSGERWFLIVAGIFLLQLGLAVLLKLYFFTITV*

MMSGGGYSALDDPKASGSVPAATGTDPQAIRFADSNLQTFPPSEARGKIAGAYRPPTDAD
DTFSSKGGGAGSGGRGGSAGSDDAAQGGWFRMFSVAAYKPYFDVDTSDVVERIWESVFPF
RGTFTEKTSENPDLYGPFWTCTTLIFVAASIATFVTYLSHKWHKKEWNYDINLVTWSAGL
FYGYVTFVPLLLYVILKYLSAPAGLVQLWCLYGYSLFIFIPASLLSIVPIEIFRWVIAGV
AGFMSATFVAVNLRAHIVNSGERWFLIVAGIFLLQLGLAVLLKLYFFTITV*

Other information
Ka divergence:0.498941KaKs divergence:0.619147
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):876Length 2 (bp):876Length divergence:0
MFE 1 (kcal):-314.42MFE 2 (kcal):-321.91MFE divergence0.012