Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G020446-GRMZM2G090722
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273126
Function (paralog2):hypothetical protein LOC100217223

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.027927899065653
Log2 mRNA fold difference:0.51245721878962
Log2 TE fold difference:-0.48352564607491
Sequences
Protein sequence

MASASMLARSLLRTPDPTQTSHPNRRSAAVVSFPRRHRRLSVRASVSTASPSPPPQPAAA
AAGVPKHCFRRGADGYLYCEGVRVEDAMTAAERSPFYLYSKPQILRNFAAYRDALQGLRS
IIGYAVKANNNLPVLRVLRELGCGAVLVSGNELRLALQAGFDPARCIFNGNGKTLEHLKL
AAESGVFVNVDSEFDLENIVRAARATGKKVPVLLRINPDVDPQVHPYVATGNKTSKFGIR
NEKLQWFLDSIKSYPNEIKLVGVHCHLGSTITKVDIFRDAAVLMLNYVDEIRAQGFKLEY
LNIGGGLGIDYHHTDAVLPTPMDLINTVRELVLSQDLTLIIEPGRSLIANTCCFVNRVTG
VKSNGTKNFIVVDGSMAELIRPSLYGAYQHIELVSPPTPGAEAATFDIVGPVCESADFLG
KDRELPTPDEGAGLVVHDAGAYCMSMASTYNLKLRPPEYWVEADGSIVKIRHGEKLDDYM
KFFDGLPA*

MAAANLLSRSLLPTPNTIRTSHPTPRSPAVVSFPRRRARLSVCASVSMASPSPPPQPAAA
GVPKHCFRRGADGYLYCEGVRVEDAMAAAERSPFYLYSKLQILRNFAAYRDALQGLRSIV
GYAVKANNNLPVLRVLRELGCGAVLVSGNELRLALQAGFDPARCIFNGNGKTLEDLKLAA
ESGVFVNVDSEFDLENIVRAARATGKKVPVLLRINPDVDPQVHPYVATGNKTSKFGIRNE
KLQWFLNSIKSYSNEIKLVGVHCHLGSTITKVDIFRDAAVLMVNYVDEIRAQGFKLEYLN
IGGGLGIDYHHTDAVLPTPMDLINTVRELVLSQDLTLIIEPGRSLIANTCCFVNRVTGVK
SNGTKNFIVVDGSMAELIRPSLYGAYQHIELVSPPTPGAEVATFDIVGPVCESADFLGKD
RELPTPDEGAGLVVHDAGAYCMSMASTYNLKLRPPEYWVEEDGSIVKIRHEEKLDDYMKF
FDGLPA*

Other information
Ka divergence:-0.264521KaKs divergence:-0.508982
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):1467Length 2 (bp):1461Length divergence:-0.002
MFE 1 (kcal):-499.55MFE 2 (kcal):-486.01MFE divergence-0.014