Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G020548-GRMZM2G310155
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100273530

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.3228739865294
Log2 mRNA fold difference:-0.90415718746402
Log2 TE fold difference:-0.38242281409265
Sequences
Protein sequence

MAKTRKPPAPPSPPPPPAETPSPQRRRKKKGRPSLLDLQRRSLRLQAQNPSPAASPTRRD
PNPSDDDEDGTGSGRRRQKRLKSVLSGVVKEEQGEGKKDAAKATGKEDAASDGGPTGTPL
PDKKLLLFILDRLQKKDTYGVFSEPVDAEELPDYFDIIDHPMDFSTIREKLLNDSYSKLE
QFEARSIEALAKKDFENLRQPSDEEEPKPPARRGRPPKNPKTEGDVSPDLSNVKANKPED
NVDTFRKRSTGDRTRNTNTPMKDLSSFHDTFGSFSAKRTDKIGDYSGSSKWGKKPVSLDD
DRRSTYDQHYSRNSSLFAALDDERKLLVPVGVQQPHAYARSLARFASKLGPVGWDVAANR
IRRALPPGTSFGPGWVVDGEPPQNSQWAPAASTNPSSEPTAPPNMPSKNDVLDHKSGPSS
NGDVTGEEHLTRTQTVASTSTSFDKSSDISSKVTKLENGVTESCGGTDNTGSAAPPMQQH
SHSREIHSNINGFTAMSNAMSQYAGQGLFGSGIHMTHAQVLGMFSGMNGKVNGYIHRHPV
TADSLKTAGQNGDVGKATVNPVQSAGQDPKTATENSSAHPGLNSRAQSSGSSPRGKLTNP
KHPDLALQL*

MAKTRMPASPPPAETPTPQRRRKKKGRPSLLDLQRRSLRLQAQNPSPDPSPTRREPNPFD
DDEDGTGSGRRRQKRFKSVLSGVVKEELGEGEKDAAKATGKGDAASDGGPAGTPLPDKKL
LLFILDRLQKKDTYGVFSEPVDAEELPDYFDIIDHPMDFSTIREKLLNDSYSKLEQFEDD
VFLLTSNAMSYNSADTIYFRQARSIEALAKKDFENLRQPSDEEEPKPPARRGRPPKNPKM
EGDASPDLSNMKTSKPEDSIDTFRKKSTGDITRNTNTTMKEPSSFHSMLGSFSAKRADKI
GDYSGSSKWGKKPVGVDDDRRSTYDQHYSCNSSLFAALDDGRKLLVPVGVQQQHAYARSL
ARFASKLGPVGWDVTANRIRRALPPGTSFGPGWVVDGEPPQNSQRGPVASTDPSSESTDP
PNMPSKNDVLHQKCGLSSNGYVTGEEHLTRTQTVASTSASSEISSKVNKLENGVTKSCGG
MGNTGSAGPPMQQLCLRGPEIRSNINGFPAMSNATSQYAGQGLFGSGIPMTHAQVLGMFS
GMNGKANGYVHRHPVAADSLKTAAQNGDVGKAAVNPVQGAGHDPKIANGNSSAHPGLNSG
VQSSGSPPRRTLANPKHPDLALQL*

Other information
Ka divergence:0.349442KaKs divergence:0.126741
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):1830Length 2 (bp):1875Length divergence:0.012
MFE 1 (kcal):-654.18MFE 2 (kcal):-654.2MFE divergence0