Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G020728-GRMZM2G095670
Species:maize
Duplication type:TD
Function (paralog1):G10-like protein
Function (paralog2):G10-like protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.27753714699919
Log2 mRNA fold difference:0.33551683332228
Log2 TE fold difference:-0.66190566246446
Sequences
Protein sequence

MPKIKTSRVKYPEGWELIEPTIRELDAKMREAENDPHDGKRKCEALWPIFRISHQRSRYI
YDLYYRRKEISQELYEFCLDQGYADRNLIAKWKKPGYERLCCLRCIQTRDHNFATTCVCR
VPKHLREEQVIECVHCGCRGCASGD*

MPKIKTSRVKYPEGWELIEPTIRELDAKMREAENDPHDGKRKCEALWPIFRISHQRSRYI
YDLYYRRKEISQELYEFCLDQGYADRNLIAKWKKPGYERLCCLRCIQTRDHNFATTCVCR
VPKHLREEQVIECVHCGCRGCASGD*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):438Length 2 (bp):438Length divergence:0
MFE 1 (kcal):-131.9MFE 2 (kcal):-128.7MFE divergence-0.012