Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G020814-GRMZM2G124701
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):C-terminal zinc-finger

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.57623944658042
Log2 mRNA fold difference:-0.60660268037789
Log2 TE fold difference:0.028954707188052
Sequences
Protein sequence

MTHRNMLWTHQSVNPEWEQRHAQVQPGSSYYAGTASDSSNLGVQVAVGVPGNTANVGICD
LRNHECPHVHNSYPHAGVTSRFVFPTTMYNPSMSAAAVNIYIPQTQSFGLGSVLPPSLHN
QVPTGTIDESSSSVNFGDSAIGFMKRKNAVVAGSHHFLHGFAGSSSSVHVPQNPVHGPWN
PSSQSNCLPSSAASNLPEYHNSNGWPYLEESSADASNSFSSVAACQELAPHGNYLYPACH
ISQSNTWVPQPAGYGVPQWGYSNAVVNPPGTADMSNGPLPHFCQNSMQAPQIQVSHQQFI
GNNAVHGLNPSATGLPLHPRMLALPFNAEHTFGHPMHPPLINQVNNGALRILPYQNATVM
DHSRIYEAGHVIDEHSDMRLDVDNMTYEELVALQEQIGDVNTGLTESYIQENLRSSFHVP
GAASMSDQFSELSLENDACIICQEEYKAKELIGTLECGHKYHVNCIKQWLMMKNLCPICK
TTALSSDRRNG*

MSYRNMLWTHQSVNPEWEQGHVQVQPRSSYYAGTVSDSSNLGMQVAVGVPVNTVNVGICD
LWNHERLPVHNSYPHASVTSRFVLPTSMYNPCMPAAAVNIYIPQTQSFGLGNVLPPSLHS
QVSTGTIDENNSSFNFGDSAIGSMKRKTAVVAGNHHILHGFAGSSSSVHVPQNPVYGPWN
ASSQSNCLPSSAASNLPEYHNSNGWPFLEESSANASNSFTSVDACPELVPHGNNLYPACH
IIQCNTWVPQTASHGVPQWGYGNVMVNPPGTVDMPNGNIQDYQAGHSSIHGPLPHFCQIP
LRSMQVPQIQVPHQQFIGNNVVHGLNPSAAGLPLDPRMLAFPFNDEHTFGHQVHPPLINQ
ANNGALRILPYQNATVMDHSRIYEAGHVIDEHRDMRLDVDNMTYEELVALQEQIGDVNTG
LTESYIQENLRSTFHVPGAASISDQFCELSLENDACIICQEEYEARELIGALECGHKYHE
DCIKQWLMVKNVCPICKTTALSSDRRNG*

Other information
Ka divergence:0.259348KaKs divergence:0.405618
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1476Length 2 (bp):1527Length divergence:0.017
MFE 1 (kcal):-442.08MFE 2 (kcal):-449.33MFE divergence0.008