Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G020928-GRMZM2G031827
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191858
Function (paralog2):splicing factor U2af 38 kDa subunit

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-3.815750133734
Log2 mRNA fold difference:-5.6291321811866
Log2 TE fold difference:1.8810775283261
Sequences
Protein sequence

MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP
GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE
QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGRDL
RRKLYGRSASRRYHGRSRSRSPPPQRRGHRDRDDYHHRDRDDYRGGGGGGRGRGSRYDRY
DDGAGRGGRHGRYDDGAGRGGRHDRYDDGGRRRHGSPSRRARSPVRESSEERRAKIEQWN
REREGKQ*

MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTLVLANMYQRPDMITP
GVDAQGQPIDPEKMQEHFEDFYEDIYEELGKFGEIENLNVCDNLADHMIGNVYVQFREEE
QAAAAYNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGRDL
RRKLYGRSASRRYHARSRSPPPQRRGYREDYHHRDRDEYRGGGGGGGRGRGSRHDRYDDG
AGRGGRHDRYDDGAGRGGRYERYDDGGRRRHGSPPRRGRSPVRESSEERRAKIEQWNRER
ESKQ*

Other information
Ka divergence:0.212136KaKs divergence:0.0149562
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):924Length 2 (bp):915Length divergence:-0.005
MFE 1 (kcal):-328.9MFE 2 (kcal):-316.71MFE divergence-0.019