Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G020976-GRMZM2G133226
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100272770

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.48445739035475
Log2 mRNA fold difference:0.21710388388899
Log2 TE fold difference:-0.7222295736921
Sequences
Protein sequence

MAKGGGERGTLLPVSADDGKGNDGGGGGDDAVLFKGSAMTRRGGAAALSYMACSVLLVMF
NKAALSSYKFPCANVITLLQMVCSTCLLYVLRRLKIISFTNSDPSVPSDSLFFVPFRLLL
RTTPLSLAYLLYMLASMESVRGVNVPMYTTLRRTTVVFTMTMEYFLAKQKHTPPIIGSVA
LIVFGAFVAGARDLSFDARGYAIVFVANITTAVYLATINRIGKSSGLNSFGLMWCNGLVC
GPSVLFLTYIQGDLKRTMEFPYLHSLGFQVVLLFSCILAFLLNYTIFWNTILNSALTQSM
CGNLKDFFTVGIGWVLFGGLPFDLLNVIGQGLGFLGSGLYAYCKIRGK*

MAKGGVERGALLPVSADDGKGNGGGAGGDDAVLFKGSAMTRRGGTAALSYMACSVLLVMF
NKAALSSYNFPCANVITLLQMVCSTCLLYVLRRLKIISFTNSDPSVPSDSLFFVPFRLLL
RTTPLSLAYLLYMLASMESVRGVNVPMYTTLRRTTVVFTMTMEYFLAKQKHTPPIIGSVA
LIVFGAFVAGARDLSFDARGYAIVFVANITTAIYLATINRIGKSSGLNSFGLMWCNGLVC
GPSVLLLTYIQGDLKRAMEFPYLYSPGFMTVLLFSCILAFLLNYTIFWNTILNSALTQSM
CGNLKDFFTVGIGWVLFGGLPFDLLNVIGQGLGFLGSGLYAYCKIKGK*

www.000webhost.com

Other information
Ka divergence:-0.0849228KaKs divergence:-0.0239669
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1047Length 2 (bp):1047Length divergence:0
MFE 1 (kcal):-341.47MFE 2 (kcal):-342.49MFE divergence0.001