Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021095-GRMZM2G145568
Species:maize
Duplication type:WGD
Function (paralog1):LOB domain protein 11
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.60656047319974
Log2 mRNA fold difference:0.067590793093327
Log2 TE fold difference:-0.85822690451018
Sequences
Protein sequence

MDDYGNASAGTAAPQPQQYYCRSVSPPSRVSSSCSPPPPPPPPAVLQVVGNVPPPTVVLS
PCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHRVFGASNIIKLLQDLPESSRADAVSS
MVYEAEARLRDPVYGCAGAVCRLQKQANELKVQLARAQADLLNAQAKHANLLALFCVEMA
NRRGNQQHPSPLTTMMDGGGGGGFGAAAYYQQTTLYDSDLDSATTWPDHEAQLWT*

MDDYGNAIVVTGTAAPLKYNCRSVSPPSSVSSSCSPPPPPPPPTPPAAVQVVVGNVAPTV
VLSPCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHRVFGASNIIKLLQDLPESSRADA
VSSMVYEAEARLRDPVYGCAGAVCRLQRQANELKVQLARAQADLLSAQAQHADLLALFCV
EMANRRGNRQQQQQPSPPTTTVDGGGGSEFGGAAYGQTFYDSDDLDSATWPDHEAQLWT*

Other information
Ka divergence:0.310117KaKs divergence:0.268581
GC content 1 (%):71GC content 2 (%):70GC content divergence:-0.007
Length 1 (bp):708Length 2 (bp):720Length divergence:0.008
MFE 1 (kcal):-367.01MFE 2 (kcal):-369.31MFE divergence0.003