Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021149-GRMZM2G022041
Species:maize
Duplication type:WGD
Function (paralog1):small nuclear ribonucleoprotein-associated protein B
Function (paralog2):hypothetical protein LOC100272538

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.8349906255585
Log2 mRNA fold difference:-0.4382187452267
Log2 TE fold difference:-1.322046758646
Sequences
Protein sequence

MSNPKGSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRRLPPSKSSKTT
GEREERRTLGLLLLRGEEVVSMTVEGPPPPDESRAKAAAAGGALAGPGIGRAAGRGVPTG
PLLQAAPGLAGPVRGVGGPAPGMMQPQISRPPMPNLSAQPVSYPQVVRPPQGMPPPMRPG
MPPQMQMPFRPPGAPPAPFPGAPPQQFMRGPPPMGPPQVRPGMPGPPPPGMRPGMPPPPF
GQPRPGMPPPPPGPQQPGQNPPQ*

MSNPKGSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRRLPPSKSSKAT
GEREERRTLGLLLLRGEEVVSMTVEGPPPPDESRAKAAAAGGALAGPGVGRAAGRGVPTG
PLLQAAPGLAGPVRGVGGPAPGMMQPQISRPPMPNLSAQPVSYPQVVRPPQGMPPPMRPG
MPPQMPMQFRPPGAPPAPFPGAPPQQYMRGPPPMGPPQVRPGMPGPPPPGMRPGMPPPPF
GQPRPGMPPPPPGPQQPGQNPPQ*

Other information
Ka divergence:0.207181KaKs divergence:0.512922
GC content 1 (%):69GC content 2 (%):72GC content divergence:0.021
Length 1 (bp):792Length 2 (bp):792Length divergence:0
MFE 1 (kcal):-375.82MFE 2 (kcal):-394.89MFE divergence0.025