Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021270-GRMZM2G121210
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193866
Function (paralog2):hypothetical protein LOC100381789

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.81537149936207
Log2 mRNA fold difference:1.8050498485628
Log2 TE fold difference:-0.99108789121319
Sequences
Protein sequence

MAAPLHSSSGHNAAAGGGAKTIEEMYQKKTQLEHILLRPDTYIGSVEKHTQALWIYEDGA
MVNRSVTYVPGLYKIFDEILVNAADNKQRDPKMDALRVEIDVDSCCISVYNNGDGIPVEV
HQEEGVYVPEMILGHLLTSSNYNDNEKKTTGGRNGYGAKLTNIFSTEFVIETADGRRQKK
YKQVFYENMGKKSEPQITKCKQGENWTRVTFKPDLAKFNMTHLEDDVVALMRKRVVDMAG
TLGKTVKVELDGQRVPIKSFCDYVDLYMKSANCDRPDNFKRIYEQVNDRWEVCVSQSEGQ
FQQVSFVNRIATIRGGSHVDYVTNQIANHVVAIVNKKNKNANMKLHNVKSHLWVFVNALI
DNPAFDSQTKETLTTRQGSFGSKCELSSDFLKKVEKSGVIENVLSWADFKLSKELKKTDG
SKKSRISGIPKLEDANEAGGKDSDKCTLILTEGDSAKALAMSGIAVVGRDYYGVFPLRGK
LLNVREANHKQIMDNAEIQHIKQILGLQHGKQYESTKGLRYGHLMIMTDQDHDGSHIKGL
LINFIHSFWPSLLKVPSFLVEFITPIIKATRGQTTKSFYTMPEYEEWRKNLGASASSWTI
KYYKGLGTSTAKEGRKYFEDIIDHKKDFVWVDDQDGNHIELAFSKKRIADRKQWLTNFQP
GTYIDQREKQVKYSDFINKELILFSMADLQRSIPSMVDGLKPGQRKILFCSFKRNFVKEA
KVAQFSGYVSEHSAYHHGEQSLASTIIGMAQNFVGSNNINLMSPNGQFGTRAQGGKDAAS
PRYIFTKLSNITRSIFPKDDDILLNYLNEDGQSIEPTWYMPILPMVLVNGSEGIGTGWST
YIPNYNPRDIVANVRRLLNEESTVPMHPWYRGFKGSIEKTVNTKVAGSTYTVTGIIEVVD
NTTLRITELPIRRWTQDYKDFLESLAPDPKNKDKVTFIEDVTSQGDNEDVYIQLKLSEAN
VNVAKEEGLVKKFKLTTTIGTTNMHLFDSDGKIRKYDTPEQILEEFFQLRLEFYCKRKEA
LLKNIKLDLKKLENKVRFIRCVVDNEIIVNNRKRADLFLELRHKNFDPFPKKKKKAEPTA
VGAIEEEENEESPETAAGVDPSDYEYLLSMSIGTLTLEKIQELNAEKQKLVDDVVELMNT
SPKSLWLKDLDAFEKELDVLDQMDLAEEVQREKRIKEGKKGGSKAAPKKQPKKAAPIKLE
SSTEDNAAEPVVAKRGAQQKKAPKKAPVDEEEVDMPSLKDRLAAFNINDSSPPDHSAMET
ETTEQPAQKKGRGKKPAAAAVKPKAPAARKRAPTQGGKATQKKIDEMLKVTEDNTSSALS
PEKKVRKMRPSPFNKKSGSILQRGSTAASASSETIAEASPPSGSSEEPVAAAKPRRTARA
TKKHVYISESDPEDEVVELSDDSDFDLDADSD*

MADLQRSIPSMVDGLKPGQRKILFCSFKRNFVKEAKVAQFSGYVSEHSAYHHGEQSLAGT
IIGMAQNFVGSNNINLMYPSGQFGTRAQGGKDAASPRYIFTKLSHITRSIFPKDDDILLN
YLNEDGQSIEPTWYMPILPMVLVNGSEGIGTGWSTYIPNYNPRDILANLRRLLNGESTVP
MHPWYRGFKGSIEKTVNTKVAGSTYTVTGIIEVLDNTTLRITELPIRRWTQDYKDYLESL
APDTKNKDKVPFIEDVTCQGDNEDVYIQFTLSEKNMNIAMEEGLVKKFKLTTTIGTSNMH
LFDSDGKIRKYDTPEQILEEFCHLRLEFYCKRKEALLKSIKLDLKKLENKVRFIRCVVDN
EIIVNNRKRADLFLELRQKNFDPFPKKKKRAEPAAVGALEEEENEESPEAAGAEPSDYEY
LLSMSIGTLTLEKIQELNAEKQKLVDDVEELENMSPKSLWLKDLDAFEKELDVLDQMDLA
EELQREKRINAGKKGGSKAAPKKPRKKAASKKLDSDTEDDDFEPAVAKRGAQPKKTSSKA
NDSASEDGDYVAAENQKKQSKKASAHVDEEVDMPSLKDRLAAFNISDSSPDHSAMETEVT
ELTEQQNENKATEGASKRGGRKKASSSLATIPSDVDEEVLEVQAQKKGRGRKPAAVVKPK
APAAARKRAPAQGKVTQKKIDEMLKATEDNNTSASSPEKKVRKMRSSPFNKKSGSILQRG
STASASSGTTVEASPPSGSSAEPVGAAQPRRTARATKKPIYISDSDPEDEVELIDDSDFD
ADGDSDE*

Other information
Ka divergence:0.0302032KaKs divergence:0.314501
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):4239Length 2 (bp):2364Length divergence:-0.284
MFE 1 (kcal):-1353.83MFE 2 (kcal):-708.53MFE divergence-0.313