Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021464-GRMZM2G092429
Species:maize
Duplication type:WGD
Function (paralog1):small nuclear ribonucleoprotein LSM1
Function (paralog2):hypothetical protein LOC100280029

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.19110827571255
Log2 mRNA fold difference:-0.32374796604596
Log2 TE fold difference:0
Sequences
Protein sequence

MSWSAPDDILLSTSLAGFLDKKLIVLLRDGRKLLGTLCSFDQFANVVLQGACERVIVGEQ
YCDVPLGLYVIRGENVVLIGELDHEKDELPAHMTCVLEAEIRKAEKAEREARDLKGTMRK
RMEFLDFD*

MGLSVYADRYIFLCVCVRFVPISECYHVSVLNGIVLCLLMEMRKSYLELVVPRGIWRQSS
EKLIVLLRDGRKLLGTLCSFDQFANVVLQGACERVIVGEQYCDVPLGLYVIRGENVVLIG
ELDREKDELPAHMTCVSEAEIRKAEKAEREARDLKGTMRKRMEFLDFD*

www.000webhost.com

Other information
Ka divergence:0.662661KaKs divergence:0.695806
GC content 1 (%):48GC content 2 (%):43GC content divergence:-0.055
Length 1 (bp):387Length 2 (bp):507Length divergence:0.134
MFE 1 (kcal):-126.5MFE 2 (kcal):-144.62MFE divergence0.067