Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021480-GRMZM2G473016
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):RHC1A

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.20276892658729
Log2 mRNA fold difference:-0.27006112320755
Log2 TE fold difference:-0.055818485350653
Sequences
Protein sequence

MSATTAPVRHRTCRMYWCYQCGRALRIISYPSTDVFCPRCFGRFLHEIDLPARPAFPPPH
FLPHPFHPQRQHDGHPRRWVIYGGEPATTVPGRAFRQPAAPAQGPATHPAPAPAPVRRRV
PSPPPPPPVLRRPTTAPAVDLGNYFTGPNLNNLIEELTQNDRPGPAPAPPSAIDSLPTVR
ITGAHLSDGSQCPVCKEDFELGEAARQLPCKHVYHSDCIVPWLRLHNSCPVCRYQLPGAG
STSNGGSQAAPRGGSDGDRNSRNGERGREPPTLVRWGPFSWLFPPHGMDDPDDAWEHGRR
GRHDAADAGAFYAWWRSLFLI*

MSSATPAPARHRTCRTYWCYQCGRALRIISCPSTDVFCPRCFGRFLHEVDPPTARHGFPP
AHFLPHPFHPQHQYAGRPRRWVIYGEEPTTVPGRAFRQPAPAQGPATPPAPAPALVRRRR
VPSPPPAPVPRRPSTPPAIDPGDYFMGPNLNSLIEELTQNDRPGPAPAPPSAIDSLPTVR
VAGAHLSDGSQCPVCKEDFELGEAARQLPCKHVYHSDCIVPWLRLHNSCPVCRYQLPRAG
SNGSSQAAPRGGSNGSNNRNREMEREPLTMVQWGPFSWPFPPRGMDDPGDAWEHGQRGRH
DAADAGDVLVESLSHPKMYASYP*

Other information
Ka divergence:0.388631KaKs divergence:-0.448977
GC content 1 (%):73GC content 2 (%):70GC content divergence:-0.021
Length 1 (bp):966Length 2 (bp):972Length divergence:0.003
MFE 1 (kcal):-512.8MFE 2 (kcal):-484.64MFE divergence-0.028