Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G021619-GRMZM2G167280
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.2083157711251
Log2 mRNA fold difference:-2.0417724490352
Log2 TE fold difference:0.87455867512133
Sequences
Protein sequence

MPPPILLPPIFLLFLVAPLAAPQPAPGSAAAPQEDDLRCLRGVKHDLADPNERLADWDFK
NTSGGAVCNYNGIGCWNLQESRVLSLSLSGFGLVGSIPSSLQYCRAATTLDLSSNALVGT
ILPALCDWLPFLVTLDLSSNQLNGPIPAELANCRFLNSLRLSGNQLSGQIPASLARLDRL
KSLDLSGNKLDGQIPSQLGDNFPMDSFSGNSGLCGRPVSSRCGRGLGSTGLGIVIAAGVF
GAAASLLLAYFFWRCTGKGKGGRRRHRRGTSESGGGEDGSWWTERLRAAHNRLVPVSLFQ
KPIVKVKLADLMAATHDFSTSHIVVAGSSRAGTAYRAVLRDGSALTVKRLHSCPLSEKAF
RAEMGRMGQLRHPNIVPLLGFCVVEDERLLVYKHMESGALSSVMKKPGEAPLDWATRLRI
AVGAARGLAWLHHGFQVPQIHQNLSSSAVLLDEDYDARITDVGLTRLVRMAPGEGGDTSP
FLNGDFGEFGYVAPEYASNPVGTMKGDAYAFGVILFELVSGQEAAAVVTDVTGEGFKGTL
VDWVNQLKASGRISDAIDKPLRGKGHEAEIQEFLKIAFACTQPRVTERHSMYRVFHALKS
IGEGCDVTEQFDEFPLAYNKDDSDAI*

MPPPRLLPPIIVLLLLAPPAAPQPAPGSEAAPQQDGLRCLRGVKHDLADPNGRLADWDFK
NTSGGAVCSYSGIGCWNLQESRVLSLSLSGFGLVGSIPSSLQYCSAATTLDLSSNALVGT
ILPALCDWLPFLVTLDLSSNQLTGAIPAELANCRFLNSLTLSGNQLSGQIPASLARLDRL
KSLDLSGNQLSGQIPPQLGDRFPRDSFSGNSGLCGRPVSSRCGRGLGSAGLGIVIAAGVL
GAAASLLLAYFFWRCSGKGKGGRRRHRRGGSESGGGEDGSWWTERLRAAHNRLAPVSLFQ
KPIVKVKLADLMAATQDFSSSHIVVAGSSRAGTAYRAVLRDGSALTVKRLHSCPLSEKAF
RAEMCRIGQLRHPNIVPLLGFCVVEDERLLVYKHMESGALSSVMKKKPGEEAPLLDWATR
LRIAVGAARGLAWLHHGFQVPQIHQNLSSSAVLLDEDYEARITDVGLTRLVRMAPGEGGD
TSPFLKGDLGEFGYVAPECASNPVGTTKGDAYAFGVVLFELVSGQEAAAAAVGTVDVMGE
GFKGTLVDWVYQLKASGRIGDAVDKSLRGKGHEAEIEEFLKVAFACTQPRVRERHSMYRV
YHALKSIGEGRDATEQFDEFPLAYNKDDSDTM*

Other information
Ka divergence:-0.0887285KaKs divergence:-0.613204
GC content 1 (%):62GC content 2 (%):68GC content divergence:0.046
Length 1 (bp):1881Length 2 (bp):1899Length divergence:0.005
MFE 1 (kcal):-820.3MFE 2 (kcal):-940.03MFE divergence0.068